shifl-PTRB

Other Species: Shigella sonnei, Shigella flexneri, Shigella dysenteriae protease II

Comment

"Other Species: Shigella flexneri (and serotype X (strain 2002017)serotype 5b (strain 8401)) and Shigella sonnei (strain Ss046) Shigella dysenteriae serotype 1 (strain Sd197)(1012)"

Relationship

Family : S9N_PREPL_Peptidase_S9

Block : X

Position in NCBI Life Tree : Shigella flexneri

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MLPKAARIPHAMTLHGDTRIDNYYWLRDDTRSQPKVLDYL
QQENSYGHRV MASQQALQDRILKEIIDRIPQREVSAPYI
KNGYRYRHIYEPGCEYAIYQR QSAFSEEWDEWETLLDAN
KRAAHSEFYSMGGMAITPDNTIMALAEDFLSR RQYGIRF
RNLETGNWYPELLDNVEPSFVWANDSWTFYYVRKHPVTLL
PYQ VWRHAIGTPASQDTLIYEEKDDTYYVSLHKTTSKHY
VVIHLASATTSEVR LLDAEMADAEPFVFLPRRKDHEYSL
DHYQHRFYLRSNRHGKNFGLYRTRM RDEQQWEELIPPRE
NIMLEGFTLFTDWLVVEERQRGLTSLRQINRKTREV IGI
AFDDPAYVTWIAYNPEPETARLRYGYSSMTTPDTLFELDM
DTGERRV LKQTEVPGFDAANYRSEHLWIVARDGVEVPVS
LVYHRKHFRKGHNPLLVY GYGSYGASIDADFSFSRLSLL
DRGFVYAIVHVRGGGELGQQWYEDGKFLK KKNTFNDYLD
ACDALLKLGYGSPSLCYAMGGSAGGMLMGVAINQRPELFH
GVIAQVPFVDVVTTMLDESIPLTTGEFEEWGNPQDPQYY
EYMKSYSPYDN VTAQAYPHLLVTTGLHDSQVQYWEPAKW
VAKLRELKTDDHLLLLCTDMDS GHGGKSGRFKSYEGVAM
EYAFLVALAQGTLPATPAD

References

Title : Emergence of a new multidrug-resistant serotype X variant in an epidemic clone of Shigella flexneri - Ye_2010_J.Clin.Microbiol_48_419
Author(s) : Ye C , Lan R , Xia S , Zhang J , Sun Q , Zhang S , Jing H , Wang L , Li Z , Zhou Z , Zhao A , Cui Z , Cao J , Jin D , Huang L , Wang Y , Luo X , Bai X , Wang P , Xu Q , Xu J
Ref : J Clin Microbiol , 48 :419 , 2010
Abstract : Ye_2010_J.Clin.Microbiol_48_419
ESTHER : Ye_2010_J.Clin.Microbiol_48_419
PubMedSearch : Ye_2010_J.Clin.Microbiol_48_419
PubMedID: 19955273
Gene_locus related to this paper: shifl-AES , shifl-BIOH , shifl-entf , shifl-FES , shifl-PLDB , shifl-PTRB , shifl-S2753 , shifl-SF1808 , shifl-SF3046 , shifl-SF3908 , shifl-yafa , shifl-YBFF , shifl-YCDJ , shifl-ycfp , shifl-YFBB , shifl-YHET , shifl-YJFP , shifl-YPFH , shiss-yqia

Title : Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a - Nie_2006_BMC.Genomics_7_173
Author(s) : Nie H , Yang F , Zhang X , Yang J , Chen L , Wang J , Xiong Z , Peng J , Sun L , Dong J , Xue Y , Xu X , Chen S , Yao Z , Shen Y , Jin Q
Ref : BMC Genomics , 7 :173 , 2006
Abstract : Nie_2006_BMC.Genomics_7_173
ESTHER : Nie_2006_BMC.Genomics_7_173
PubMedSearch : Nie_2006_BMC.Genomics_7_173
PubMedID: 16822325
Gene_locus related to this paper: shifl-AES , shifl-BIOH , shifl-entf , shifl-FES , shifl-PTRB , shifl-S2753 , shifl-SF1808 , shifl-SF3046 , shifl-yafa , shifl-YBFF , shifl-YCDJ , shifl-ycfp , shifl-YCJY , shifl-YFBB , shifl-YHET , shifl-YIEL , shifl-YJFP , shifl-YPFH , shiss-yeiG , shiss-yqia

Title : Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery - Yang_2005_Nucleic.Acids.Res_33_6445
Author(s) : Yang F , Yang J , Zhang X , Chen L , Jiang Y , Yan Y , Tang X , Wang J , Xiong Z , Dong J , Xue Y , Zhu Y , Xu X , Sun L , Chen S , Nie H , Peng J , Xu J , Wang Y , Yuan Z , Wen Y , Yao Z , Shen Y , Qiang B , Hou Y , Yu J , Jin Q
Ref : Nucleic Acids Research , 33 :6445 , 2005
Abstract : Yang_2005_Nucleic.Acids.Res_33_6445
ESTHER : Yang_2005_Nucleic.Acids.Res_33_6445
PubMedSearch : Yang_2005_Nucleic.Acids.Res_33_6445
PubMedID: 16275786
Gene_locus related to this paper: ecoli-yeiG , shidy-IROD , shidy-q67dv1 , shifl-AES , shifl-BIOH , shifl-entf , shifl-FES , shifl-PLDB , shifl-PTRB , shifl-S2753 , shifl-SF1334 , shifl-SF1808 , shifl-SF3046 , shifl-SF3908 , shifl-yafa , shifl-YBFF , shifl-YCDJ , shifl-ycfp , shifl-YCJY , shifl-YFBB , shifl-YHET , shifl-YJFP , shifl-YPFH , shiss-yaim , shiss-yeiG , shiss-yqia

Title : Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T - Wei_2003_Infect.Immun_71_2775
Author(s) : Wei J , Goldberg MB , Burland V , Venkatesan MM , Deng W , Fournier G , Mayhew GF , Plunkett G, 3rd , Rose DJ , Darling A , Mau B , Perna NT , Payne SM , Runyen-Janecky LJ , Zhou S , Schwartz DC , Blattner FR
Ref : Infect Immun , 71 :2775 , 2003
Abstract : Wei_2003_Infect.Immun_71_2775
ESTHER : Wei_2003_Infect.Immun_71_2775
PubMedSearch : Wei_2003_Infect.Immun_71_2775
PubMedID: 12704152
Gene_locus related to this paper: ecoli-yafa , ecoli-ycfp , ecoli-yqia , ecoli-YfhR , shifl-BIOH , shifl-FES , shifl-PLDB , shifl-PTRB , shifl-SF1808 , shifl-SF3046 , shifl-yafa , shifl-YBFF , shifl-YCDJ , shifl-YFBB , shifl-YHET , shifl-YIEL , shifl-YJFP , shifl-YPFH

Title : Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157 - Jin_2002_Nucleic.Acids.Res_30_4432
Author(s) : Jin Q , Yuan Z , Xu J , Wang Y , Shen Y , Lu W , Wang J , Liu H , Yang J , Yang F , Zhang X , Zhang J , Yang G , Wu H , Qu D , Dong J , Sun L , Xue Y , Zhao A , Gao Y , Zhu J , Kan B , Ding K , Chen S , Cheng H , Yao Z , He B , Chen R , Ma D , Qiang B , Wen Y , Hou Y , Yu J
Ref : Nucleic Acids Research , 30 :4432 , 2002
Abstract : Jin_2002_Nucleic.Acids.Res_30_4432
ESTHER : Jin_2002_Nucleic.Acids.Res_30_4432
PubMedSearch : Jin_2002_Nucleic.Acids.Res_30_4432
PubMedID: 12384590
Gene_locus related to this paper: ecoli-Aes , ecoli-yafa , ecoli-ycfp , ecoli-yqia , ecoli-YfhR , shifl-AES , shifl-BIOH , shifl-entf , shifl-FES , shifl-PLDB , shifl-PTRB , shifl-SF1334 , shifl-SF1808 , shifl-SF3046 , shifl-SF3908 , shifl-yafa , shifl-YBFF , shifl-YCDJ , shifl-YCJY , shifl-YFBB , shifl-YHET , shifl-YIEL , shifl-YJFP , shifl-YPFH