Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stahy-lipas

Staphylococcus hyicus gene for lipase SHyL

Comment
Rosenstein R, Gotz F a review on Staphylococcal lipases. There is a long precursor which is cut to a 46kDa active form


Relationship
Family|Bacterial_lip_FamI.6
Block| L
Position in NCBI Life Tree|Staphylococcus hyicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus hyicus: N E


Molecular evidence
Database
No mutation
1 structure:
2HIH: Crystal structure of Staphylococcus hyicus lipase
No kinetic





No Substrate
1 inhbitor:
l,2-Dioctylcarbamoylglycero-3-O-p-nitrophenyloctylphosphonate
1 Genbank : X02844
1 UniProt : P04635
1 Structure : 2HIH
1 UniProt : P04635
1 Interpro : P04635
1 Pfam : P04635
1 PIRSF : P04635
1 SUPERFAM : P04635
Sequence
Graphical view for this peptide sequence: stahy-lipas
Colored MSA for Bacterial_lip_FamI.6 (raw)
MARIRARGSSRVDVPKENTTAQNKFTSQASDKKPTVKAAPEAVQNPENPK
NKDPFVFVHGFTGFVGEVAAKGENYWGGTKANLRNHLRKAGYETYEASVS
ALASNHERAVELYYYLKGGRVDYGAAHSEKYGHERYGKTYEGVLKDWKPG
HPVHFIGHSMGGQTIRLLEHYLRFGDKAEIAYQQQHGGIISELFKGGQDN
MVTSITTIATPHNGTHASDDIGNTPTIRNILYSFAQMSSHLGTIDFGMDH
WGFKRKDGESLTDYNKRIAESKIWDSEDTGLYDLTREGAEKINQKTELNP
NIYYKTYTGVATHETQLGKHIADLGMEFTKILTGNYIGSVDDILWRPNDG
LVSEISSQHPSDEKNISVDENSELHKGTWQVMPTMKGWDHSDFIGNDALD
TKHSAIELTNFYHSISDYLMRIEKAESTKNA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARIRARGSSRVDVPKENTTAQNKFTSQASDKKPTVKAAPEAVQNPENPK
NKDPFVFVHGFTGFVGEVAAKGENYWGGTKANLRNHLRKAGYETYEASVS
ALASNHERAVELYYYLKGGRVDYGAAHSEKYGHERYGKTYEGVLKDWKPG
HPVHFIGHSMGGQTIRLLEHYLRFGDKAEIAYQQQHGGIISELFKGGQDN
MVTSITTIATPHNGTHASDDIGNTPTIRNILYSFAQMSSHLGTIDFGMDH
WGFKRKDGESLTDYNKRIAESKIWDSEDTGLYDLTREGAEKINQKTELNP
NIYYKTYTGVATHETQLGKHIADLGMEFTKILTGNYIGSVDDILWRPNDG
LVSEISSQHPSDEKNISVDENSELHKGTWQVMPTMKGWDHSDFIGNDALD
TKHSAIELTNFYHSISDYLMRIEKAESTKNA


References
15 more
    Title: Structural basis of phospholipase activity of Staphylococcus hyicus lipase
    Tiesinga JJ, van Pouderoyen G, Nardini M, Ransac S, Dijkstra BW
    Ref: Journal of Molecular Biology, 371:447, 2007 : PubMed

            

    Title: Staphylococcal lipases: biochemical and molecular characterization
    Rosenstein R, Gotz F
    Ref: Biochimie, 82:1005, 2000 : PubMed

            

    Title: Staphylococcal lipases: molecular characterisation, secretion, and processing
    Gotz F, Verheij HM, Rosenstein R
    Ref: Chemistry & Physic of Lipids, 93:15, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer