Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strag-a0a076z217

Streptococcus agalactiae. Uncharacterized protein

Comment
Other strains: Streptococcus sp. Streptococcus agalactiae (ATCC 13813 / DSM 2134 / JCM 5671 / NCIMB 701348 / NCTC 8181; ATCC BAA-611 / 2603 V/R; NEM316; FSL S3-026; serotype V; serotype III; FSL S3-170; FSL C1-494; FSL C1-487; FSL S3-586; FSL S3-251)


Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Streptococcus agalactiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus agalactiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6OYC: Glycosylation Associate Protein (Gap123) complex from Streptococcus agalactiae (protein2 is Asp2)
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: strag-a0a076z217
Colored MSA for Asp2 (raw)
MSKIKLTILQVGEENWATKENIPNNMEWLFIKPDQISDFVTTENNYLTSS
KLLQKLPRKISALLLTEQTYGPELSSLSSFFEVYEVFYPKDKHATGITEE
FLRSKMAQRYDSSSPDQLIRQFYKGLFIGQYGEKLQVSQIQIRNDFEGVV
NYQGNNYLELEGQFGENYSFLLNFAYNIPFSSDFYNELFLEHIIEGDIDI
RLVISLIVDGSVDDIAKEWYFEKEDLNQLISLESDISGSLAVKLFAKGKG
IVKLGPLHRRNGRGGLGTFLLGGERHIDAIGHEFMTYFDPVDFKPPLTVY
FSGFRSAEGFEGFWMMKSMKTPFMLICDPRLQGGAFYIGSKEYEQKIVDA
IQEKLAFLNFSSDQLILSGLSMGTYGATYHGAKLNPHAIIIGKPIFNLGT
VAQRERLERPDGFATSLDIQLLNQGDLTSSSSEKLNNYFWKSIEEGDFSN
TTFALAYMKNDDYDATAFSDLLQYFRGKKHKILGRGWDGRHGDCSAEVGA
WFTSQYRRMLSNDFGRKEE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKIKLTILQVGEENWATKENIPNNMEWLFIKPDQISDFVTTENNYLTSS
KLLQKLPRKISALLLTEQTYGPELSSLSSFFEVYEVFYPKDKHATGITEE
FLRSKMAQRYDSSSPDQLIRQFYKGLFIGQYGEKLQVSQIQIRNDFEGVV
NYQGNNYLELEGQFGENYSFLLNFAYNIPFSSDFYNELFLEHIIEGDIDI
RLVISLIVDGSVDDIAKEWYFEKEDLNQLISLESDISGSLAVKLFAKGKG
IVKLGPLHRRNGRGGLGTFLLGGERHIDAIGHEFMTYFDPVDFKPPLTVY
FSGFRSAEGFEGFWMMKSMKTPFMLICDPRLQGGAFYIGSKEYEQKIVDA
IQEKLAFLNFSSDQLILSGLSMGTYGATYHGAKLNPHAIIIGKPIFNLGT
VAQRERLERPDGFATSLDIQLLNQGDLTSSSSEKLNNYFWKSIEEGDFSN
TTFALAYMKNDDYDATAFSDLLQYFRGKKHKILGRGWDGRHGDCSAEVGA
WFTSQYRRMLSNDFGRKEE


References
    Title: Genomic analysis reveals the molecular basis for capsule loss in the group B Streptococcus population
    Rosini R, Campisi E, De Chiara M, Tettelin H, Rinaudo D, Toniolo C, Metruccio M, Guidotti S, Sorensen UB and Margarit I <5 more author(s)>
    Ref: PLoS ONE, 10:e0125985, 2015 : PubMed

            

    Title: vanG element insertions within a conserved chromosomal site conferring vancomycin resistance to Streptococcus agalactiae and Streptococcus anginosus
    Srinivasan V, Metcalf BJ, Knipe KM, Ouattara M, McGee L, Shewmaker PL, Glennen A, Nichols M, Harris C and Beall B <6 more author(s)>
    Ref: MBio, 5:e01386, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer