xentr-d2x2k7
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Neuroligin 4
Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amphibia: N E > Batrachia: N E > Anura: N E > Pipoidea: N E > Pipidae: N E > Xenopodinae: N E > Xenopus [genus]: N E > Silurana: N E > Xenopus tropicalis: N E
A85-EsteraseD-FGH :
xentr-q5m8u4 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical loc496692 .
ABHD6-Lip :
xentr-b1wbh7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100145783 protein ,
xentr-f6rff6 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein .
ABHD8 :
xentr-a4ihf1 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Abhydrolase domain-containing 8 .
ABHD10 :
xentr-f7eue5 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Abhydrolase domain-containing 10 .
ABHD11-Acetyl_transferase :
xentr-abhdb Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Abhydrolase domain-containing protein 11 .
ABHD12-PHARC :
xentr-abd12 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Abhydrolase domain-containing protein 12 .
ABHD13-BEM46 :
xentr-a9jtx5 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). LOC100127876 protein .
ABHD16 :
xentr-q6dig9 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hla-b associated transcript 5 .
ABHD17-depalmitoylase :
xentr-q5m904 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical loc496639 ,
xentr-q6dey3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) mgc89389 protein ,
xentr-q6gl10 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) mgc69445 protein .
ABHD18 :
xentr-a4ii67 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100124957 protein ,
xentr-f7cpl7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Uncharacterized protein .
abh_upf0017 :
xentr-q4va73 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc108095 ,
xentr-f7equ8 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Abhydrolase domain containing 15 ,
xentr-f7dd89 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Peptidase_S15 domain-containing protein .
ACHE :
xentr-ACHE Xenopus tropicalis acetylcholinesterase .
Acidic_Lipase :
xentr-q5fv95 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) mgc97855 protein .
Arb2_FAM172A :
xentr-f172a Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Protein FAM172A .
Arylacetamide_deacetylase :
xentr-q6dir7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) mgc89272 protein ,
xentr-f6z8f0 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Arylacetamide deacetylase-like 4 ,
xentr-f7d709 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Uncharacterized protein .
BCHE :
xentr-a9umk0 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100135377 protein ,
xentr-BCHE1 Xenopus tropicalis butyrylcholinesterase 1 ,
xentr-BCHE2 Xenopus tropicalis butyrylcholinesterase 2 .
Carboxypeptidase_S10 :
xentr-q28c48 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Carboxypeptidase protective protein for beta-galactosidase (galactosialidosis) ,
xentr-q28dc5 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) carboxypeptidase, vitellogenic-like .
Carb_B_Chordata :
xentr-b0bm77 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100144981 protein ,
xentr-cxest2 Xenopus tropicalis Xenopus tropicalis cDNA clone MGC:89138 IMAGE:7007460, complete ,
xentr-f6v0g3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein ,
xentr-f6v2j6 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein ,
xentr-f6y4c8 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein ,
xentr-f6yve5 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein ,
xentr-LOC394897 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) loc394897 protein (fragment) .
CGI-58_ABHD5_ABHD4 :
xentr-q5bki2 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein abhydrolase domain containing 5 ,
xentr-q28d58 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) abhydrolase domain containing 4 .
Cholesterol_esterase :
xentr-b0bm89 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100144991 protein ,
xentr-f7e2e2 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein .
CIB-CCG1-interacting-factor-B :
xentr-f7a4y9 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein ,
xentr-q0vfb6 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Putative uncharacterized protein LOC550030 .
CMBL :
xentr-q6p7k0 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc76315 .
DPP4N_Peptidase_S9 :
xentr-a0jm46 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC779598 protein ,
xentr-a4ihz7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100124922 protein ,
xentr-a4iix6 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100125080 protein ,
xentr-a8kbe5 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100127648 protein ,
xentr-a9ulg1 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Fap protein ,
xentr-q28cn9 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) 2) .
Epoxide_hydrolase :
xentr-ephx3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Abhydrolase domain-containing protein 9 ,
xentr-q6dj15 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) epoxide hydrolase 2, cytoplasmic .
FSH1 :
xentr-ovca2 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Ovarian cancer-associated gene 2 protein homolog .
Hepatic_Lipase :
xentr-b0bmb8 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Lipc protein .
Kynurenine-formamidase :
xentr-f7ejk4 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Uncharacterized protein .
LIDHydrolase :
xentr-q0vfe8 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC779625 protein .
Lipoprotein_Lipase :
xentr-f6xb15 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Lipase, endothelial ,
xentr-f7e1r2 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Lipoprotein lipase .
LYsophospholipase_carboxylesterase :
xentr-q5rju7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical loc496699 ,
xentr-q6djb2 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) lysophospholipase II ,
xentr-q6p346 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc75683 .
Maspardin-ACP33-SPG21_like :
xentr-b7zt03 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein .
MEST-like :
xentr-q6dj56 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) mesoderm specific transcript homolog .
Monoglyceridelipase_lysophospholip :
xentr-f6q8j8 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Uncharacterized protein .
Ndr_family :
xentr-ndrg1 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) ndrg4-prov protein ,
xentr-ndrg2 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) ndrg2-prov protein ,
xentr-ndrg3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) ndrg family member 3 ,
xentr-ndrg4 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) ndrg family member 4 .
Neuroligin :
xentr-d2x2k4 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Neuroligin 1 ,
xentr-d2x2k6 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Neuroligin 3 .
NLS3-Tex30 :
xentr-b2guc4 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100158552 protein ,
xentr-b7ztj4 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein .
Palmitoyl-protein_thioesterase :
xentr-q6deu7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) infantile) .
Pancreatic_lipase :
xentr-q5eb42 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) mgc97608 protein ,
xentr-q6p2z1 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc76224 ,
xentr-f7af63 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Pancreatic lipase ,
xentr-a0a1b8y2w9 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Pancreatic lipase ,
xentr-f7d4k9 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Pancreatic lipase ,
xentr-f6r032 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Pancreatic lipase ,
xentr-f6yvq3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Pancreatic lipase ,
xentr-a0a1b8y2z3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Pancreatic lipase ,
xentr-f7afg4 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Pancreatic lipase .
PC-sterol_acyltransferase :
xentr-q6dj79 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) lecithin-cholesterol acyltransferase .
Pectinacetylesterase-Notum :
xentr-b1h0y7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100145278 protein ,
xentr-f6yj44 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Uncharacterized protein .
Phospholipase :
xentr-q5xge9 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical loc496511 .
Prolylcarboxypeptidase :
xentr-a4ihi0 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100124847 protein ,
xentr-b1wb75 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) LOC100145763 protein ,
xentr-q08d72 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Prolylcarboxypeptidase (Angiotensinase C) .
S9N_PPCE_Peptidase_S9 :
xentr-q6p4w3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc76255 .
SERHL :
xentr-f6u7u3 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Serine hydrolase-like 2 .
Thioesterase :
xentr-q6nvk7 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) hypothetical protein mgc69559 thioesterase domain containing 1 .
Thyroglobulin :
xentr-f6v3z1 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein .
Valacyclovir-hydrolase :
xentr-f7acc5 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uncharacterized protein Molecular evidence
Database
No mutation No structure No kinetic
Sequence
Graphical view for this peptide sequence: xentr-d2x2k7 Colored MSA for Neuroligin (raw)
MSRPNGLLWLPLIFTPVCVLVNSNLLLWIAALAVRFTIVDCQAQHPIVPT
NYGKIRGTRTPLPIEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGI
KNATQFAPVCPQFLDERSLLNDMLPIWFTANLDTVVSYVQDQNEDCLYLN
IYVPTEDDIHDPNNKKPVMVYIHGGSYMEGTGNMIDGSILASHGNVIVIT
VNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIEENIGAFGGDPKRVTI
FGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCDMLDTIDLVECLRDKNYKELIQQSITPATYHIAFGPVIDGDVIP
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGMVDNEDGVSLSDFDFSVS
NFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
APAVATADLHARYGSPTYFYAFYHHCQSEMKPTWADSAHGDEVPYVFGIP
MIGPTELFNCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTK
PNRFEEVAWSKYDPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSYPHVTRRPPLKPRITTKRPAMTPANNAKET
QKNVLGENTIITEDKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKR
RHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECEALQAHDTLR
LTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQN
STNLPHGHSTTRV
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M S R P N G L L W L P L I F T P V C V L V N S N L L L W I A A L A V R F T I V D C Q A Q H P I V P T N Y G K I R G T R T P L P I E I L G P V E Q Y L G V P Y A S P P T G E R R F Q P P E P P S S W T G I K N A T Q F A P V C P Q F L D E R S L L N D M L P I W F T A N L D T V V S Y V Q D Q N E D C L Y L N I Y V P T E D D I H D P N N K K P V M V Y I H G G S Y M E G T G N M I D G S I L A S H G N V I V I T V N Y R L G V L G F L S T G D Q A A K G N Y G L L D Q I Q A L R W I E E N I G A F G G D P K R V T I F G S G A G A S C V S L L T L S H Y S E G L F Q K A I I Q S G T A L S S W A V N Y Q P A K Y T R I L A D K V G C D M L D T I D L V E C L R D K N Y K E L I Q Q S I T P A T Y H I A F G P V I D G D V I P D D P Q I L M E Q G E F L N Y D I M L G V N Q G E G L K F V D G M V D N E D G V S L S D F D F S V S N F V D N L Y G Y P E G K D T L R E T I K F M Y T D W A D K E N P E T R R K T L V A L F T D H Q W V A P A V A T A D L H A R Y G S P T Y F Y A F Y H H C Q S E M K P T W A D S A H G D E V P Y V F G I P M I G P T E L F N C N F S K N D V M L S A V V M T Y W T N F A K T G D P N K P V P Q D T K F I H T K P N R F E E V A W S K Y D P K D Q L Y L H I G L K P R V R D H Y R A T K V A F W L E L V P H L H N L N E I F Q Y V S T T T K V P P P D M T S Y P H V T R R P P L K P R I T T K R P A M T P A N N A K E T Q K N V L G E N T I I T E D K R D Y S T E L S V T I A V G A S L L F L N I L A F A A L Y Y K K D K R R H E T H R R P S P Q R N T T N D I A H I Q N E E I M S L Q M K Q L E H D H E C E A L Q A H D T L R L T C P P D Y T L T L R R S P D D I P L M T P N T I T M I P N T L T G M Q P L H T F N T F S G G Q N S T N L P H G H S T T R V no DNA
Reference
Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
Rissone A , Sangiorgio L , Monopoli M , Beltrame M , Zucchi I , Bussolino F , Arese M , Cotelli F
Ref: Developmental Dynamics, 239 :688, 2010 : PubMed Abstract ESTHER: Rissone_2010_Dev.Dyn_239_688 PubMedSearch: Rissone 2010 Dev.Dyn 239 688 PubMedID: 20034102 Gene_locus related to this paper: anoca-d2x2h9 ,
anoca-nlgn2 ,
anoca-nlgn4 ,
chick-d3wgl5 ,
chick-nlgn1 ,
chick-NLGN3 ,
ciosa-d2x2f8 ,
danre-1neur ,
danre-32neur ,
danre-d2x2g1 ,
danre-d2x2g3 ,
danre-d2x2g5 ,
danre-nlgn2a ,
danre-nlgn4a ,
gasac-d2x2j3 ,
gasac-d2x2j4 ,
gasac-nlgn2a ,
gasac-nlgn2b ,
gasac-nlgn4 ,
human-NLGN1 ,
human-NLGN3 ,
mondo-d2x2i6 ,
mondo-d2x2i8 ,
mondo-d2x2i9 ,
oryla-d2x2i4 ,
oryla-d2x2i5 ,
oryla-nlgn2 ,
takru-1neur ,
takru-2bneur ,
takru-3bneur ,
takru-nlgn2a ,
takru-nlgn3a ,
takru-nlgn4a ,
tetng-3neur ,
tetng-4neur ,
tetng-nlgn2b ,
tetng-nlgn2a ,
tetng-nlgn3b ,
xentr-d2x2k4 ,
xentr-d2x2k6 ,
xentr-d2x2k7 Abstract
Neuroligins constitute a family of transmembrane proteins localized at the postsynaptic side of both excitatory and inhibitory synapses of the central nervous system. They are involved in synaptic function and maturation and recent studies have linked mutations in specific human Neuroligins to mental retardation and autism. We isolated the human Neuroligin homologs in Danio rerio. Next, we studied their gene structures and we reconstructed the evolution of the Neuroligin genes across vertebrate phyla. Using reverse-transcriptase polymerase chain reaction, we analyzed the expression and alternative splicing pattern of each gene during zebrafish embryonic development and in different adult organs. By in situ hybridization, we analyzed the temporal and spatial expression pattern during embryonic development and larval stages and we found that zebrafish Neuroligins are expressed throughout the nervous system. Globally, our results indicate that, during evolution, specific subfunctionalization events occurred within paralogous members of this gene family in zebrafish.
         Other Papers