Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yere8-a1jmx1

Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) putative hydrolase

Relationship
Family|RutD
Block| X
Position in NCBI Life Tree|Yersinia enterocolitica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia enterocolitica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM286415
1 UniProt : A1JMX1
1 UniProt : A1JMX1
1 Interpro : A1JMX1
1 Pfam : A1JMX1
1 PIRSF : A1JMX1
1 SUPERFAM : A1JMX1
Sequence
Graphical view for this peptide sequence: yere8-a1jmx1
Colored MSA for RutD (raw)
MYFEITGQNSPAAKTVVLSAGLGGSGRFWQPQLSALGQHFRVITYDQYGT
GRSAGVIPSGYTLADMADELADLLASQHIERYHFVGHALGGMIGLQLALS
HPQCVERLVAINSWPVLDSQTRRCFHVRQDLLLNSGVAAYVRAQPLFLYP
ADWLSRNTLLLEQEEVQQIAHFQGMENLLRRLNALMNADFRSVLPHITTP
TLALCATDDLLVPYPCSQALAELLPDGEWAQMSYGGHAMSVTNSEQFNGI
LLSYLLMDTGIAKCELALNQSNTSAIHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYFEITGQNSPAAKTVVLSAGLGGSGRFWQPQLSALGQHFRVITYDQYGT
GRSAGVIPSGYTLADMADELADLLASQHIERYHFVGHALGGMIGLQLALS
HPQCVERLVAINSWPVLDSQTRRCFHVRQDLLLNSGVAAYVRAQPLFLYP
ADWLSRNTLLLEQEEVQQIAHFQGMENLLRRLNALMNADFRSVLPHITTP
TLALCATDDLLVPYPCSQALAELLPDGEWAQMSYGGHAMSVTNSEQFNGI
LLSYLLMDTGIAKCELALNQSNTSAIHL


Reference
    Title: The complete genome sequence and comparative genome analysis of the high pathogenicity Yersinia enterocolitica strain 8081
    Thomson NR, Howard S, Wren BW, Holden MT, Crossman L, Challis GL, Churcher C, Mungall K, Brooks K and Prentice MB <12 more author(s)>
    Ref: PLoS Genet, 2:e206, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer