Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeren-YqiA

Yersinia enterocolitica esterase YqiA (YE3661) A1JQU0

Comment
Other strains: Yersinia enterocolitica (serotype O:8 / biotype 1B 8081; subsp. palearctica (serotype O:3 DSM 13030 / CIP 106945 / Y11; serotype O:9 / biotype 3 105.5R(r)); Yersinia kristensenii ATCC 33638; Yersinia rohdei ATCC 43380


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Yersinia pestis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia pseudotuberculosis complex: N E > Yersinia pestis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4FLE: Crystal structure of the esterase YqiA (YE3661) A1JQU0 from Yersinia enterocolitica, Northeast Structural Genomics Consortium Target YeR85 (CASP Target)
No kinetic





No Substrate
No inhibitor
2 Genbank : AM286415, CAL13689
1 UniProt : A1JQU0
1 Structure : 4FLE
1 UniProt : A1JQU0
1 Interpro : A1JQU0
1 Pfam : A1JQU0
1 PIRSF : A1JQU0
1 SUPERFAM : A1JQU0
Sequence
Graphical view for this peptide sequence: yeren-YqiA
Colored MSA for abh_upf00227 (raw)
MMSTLLYIHGFNSSPSSAKATTFKSWLQQHHPHIEMQIPQLPPYPAEAAE
MLESIVMDKAGQSIGIVGSSLGGYFATWLSQRFSIPAVVVNPAVRPFELL
SDYLGENQNPYTGQKYVLESRHIYDLKAMQIEKLESPDLLWLLQQTGDEV
LDYRQAVAYYTPCRQTVESGGNHAFVGFDHYFSPIVTFLGLATA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMSTLLYIHGFNSSPSSAKATTFKSWLQQHHPHIEMQIPQLPPYPAEAAE
MLESIVMDKAGQSIGIVGSSLGGYFATWLSQRFSIPAVVVNPAVRPFELL
SDYLGENQNPYTGQKYVLESRHIYDLKAMQIEKLESPDLLWLLQQTGDEV
LDYRQAVAYYTPCRQTVESGGNHAFVGFDHYFSPIVTFLGLATA


References
    Title: Complete genome sequence of Yersinia enterocolitica subsp. palearctica serogroup O:3
    Batzilla J, Hoper D, Antonenka U, Heesemann J, Rakin A
    Ref: Journal of Bacteriology, 193:2067, 2011 : PubMed

            

    Title: Complete genome sequence of a Yersinia enterocolitica Old World (3/O:9) strain and comparison with the New World (1B/O:8) strain
    Wang X, Li Y, Jing H, Ren Y, Zhou Z, Wang S, Kan B, Xu J, Wang L
    Ref: J Clin Microbiol, 49:1251, 2011 : PubMed

            

    Title: The complete genome sequence and comparative genome analysis of the high pathogenicity Yersinia enterocolitica strain 8081
    Thomson NR, Howard S, Wren BW, Holden MT, Crossman L, Challis GL, Churcher C, Mungall K, Brooks K and Prentice MB <12 more author(s)>
    Ref: PLoS Genet, 2:e206, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer