Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Dienelactone_hydrolase

Dienelactone_hydrolase


Genes:Proteins in Dienelactone_hydrolase (429)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9agar-a0a0d0c2l3: Gymnopus luxurians FD-317 M1. Unplaced genomic scaffold GYMLUscaffold_19, whole genome shotgun sequenceGymnopus luxurians FD-317 M1 Show
MSFCDDCFKGVTHEGTPKGHWEKIGGIDCYVGIPSDIEYPKDKALLFLSD
VFGMQLVNNRLLVDDFAANGILTYGVDYFFGDPMPADAMNSETFDRDAWR
AQHGYDRTRPAVDAVIAALKEKGIQSFGATGYCFGAAYTVPLAIENVIQV
AAVSHPSRLKVPEDLEKYASVSKAPFLINSCEVDAMFPKESQAKADEIFG
NDKFAPGYKREYFPGCKHGFAVRGDMNDTKVKAGKEGAFKATVEWMKKCL
9agar-a0a0d0ccz4: Gymnopus luxurians FD-317 M1. Unplaced genomic scaffold GYMLUscaffold_88, whole genome shotgun sequenceGymnopus luxurians FD-317 M1 Show
MSFCEHCVKGVTHEGEPKGKWEEINGVNCYITTPTNDYPKDKAIIFLTDL
FGPQLINSRLLADDFAANGFKTIVPDIFNGDAAPADALNPGSTWDLMAWF
GKHGPEVTRPPIDKVLESLKKDGVTSFGVLGYCFGGRYAFDLAFDGVPKA
VAVAHPSLLQIPSDLEKYVSTAKAPLLINSCTVDSQFPLEAATQADKIFA
NFAPGYKREYFEGCTHGFAVRGDISDPKVKAGKEGAFKATVEWLIKYL
9agar-a0a0d2kgs8: Hypholoma sublateritium FD-334 SS-4. Uncharacterized proteinHypholoma sublateritium FD-334 SS-4 Show
MSFCENCVKGVTHEGTPQGKWEEIGGVKTYVATPTVDYPKDKAILFLPDV
FGPQLINNQLLADDFAANGFKTYVPDYLNGDPIPPDALNPGQTFDIMQWF
PTHTQEFTRPPLDKVIAALKAEGVTSFGATGYCFGGRYVFDLAFDNVIKV
GVVSHPSLLKTPDDLVKYVAQSKAPLLINSCTTDSQFPLESSAKADELFA
GFAPGYKREHFEGLTHGFAVRGDISKPAEKAGKEGAFKSAVEWFIAKL
9agar-a0a0d7aeu9: Fistulina hepatica ATCC 64428. Alpha/beta-hydrolase, 1 reference(s)Fistulina hepatica ATCC 64428 Show
MSFCADCVRGVTHEGTPQGKIEAINDVECYIATPEGEYAKDVVLLFLTDV
FGIPLNNNKLLADDFARNGIKTIIPDYLNGDPVPADAMSPGSTFSLDPWK
AIHTPVATRPLLDRVVQGLRDQGVTKFAATGYCFGGRYTFDLAFDGVIKV
AVVAHPSLLQVPSDLEKYRDTAKAPLLINSCENDGAFPKEAQAKADEILG
NGKFAPGYKREYFAGCTHGFAVRGDLSNPLVKAGKEKAFKSTVEWLKNHL
9agar-a0a0d7ag53: Fistulina hepatica ATCC 64428. Alpha/beta-hydrolase, 1 reference(s)Fistulina hepatica ATCC 64428 Show
MSFCADCVRGVTHGGTPQGKIETLNGVECYIATPEGEYSRDTVLLFLTDV
FGVPLNNNKLLADDFASNGIKTVIPDYLNGDPKPADSLSPGSTFDMASWR
PRHTPTVTRPPLDKVIQGLREQGVTTFAASGYCFGGRFVFDLAFDGVIRV
AVVAHPSMLEIPGDLVKYRDTAKAPLLINSCETDRAFPKEAQEKADEILG
GGQFTPGYKREYFAGCTHGFAVRGDMSDPLVKAGKEGAFKSTVEWLKNHL
9agar-a0a0d7b8a5: Cylindrobasidium torrendii FP15055 ss-10. Alpha/beta-hydrolase, 1 reference(s)Cylindrobasidium torrendii FP15055 ss-10 Show
MLDAHFSTIPTFSLYLQPNLSATMSLCSKCVSGVTHEGTPTGTLETIGGI
QCYVATPEGDYPKDKVILFLCDIFGIPLVNSKLLADDFAKNGFKTIIPDY
IVEPVPVAEMDAGNYDVVSWLGRHGPEVTRPILDNVVAALRAEGVSSIGA
TGYCFGRYVFDLAFDNAIEVAVISHPSLLKIPVDLEKYVAASKAPLLINS
CEIDIPFPIEAQALADKIFGSFEYGYKREYFEGCEHGFAVRGDLSDPKVK
AGKEGSFKASAKWFKQHL
9agar-a0a2a9nrv1: Amanita thiersii Skay4041. Uncharacterized proteinAmanita thiersii Skay4041 Show
MSFCKDCVKGVRHEGTPSGKWEKIGGIDCYVATPTVDYPKNKVILYLADI
FGIQLNNAQLLCDDFANNGFKVVAPDYFNGDFAPADAMSPGSTWDLMQWF
PNHGPQQTRPVLDAVINALKEQGVSSFGATGYCFGGRYVFDLAFDHVIDV
SVVSHPSLLQVPADLEKYKQVAKAPLLINSCTVDTQFPLEAQAKADELLK
DKFAPGYKREYFDGCTHGFAVRGDLSDPKVKAGKEGAFKSAVEWFQNHM
9agar-a0a284r3u3: Armillaria ostoyae. Related to hydrolase related to dienelactone hydrolaseArmillaria ostoyae Show
MSLCKDCITGVTHEGTPTGKIEQIGGVECYVATPSKEYSNNKVILFLPDA
FGITLPNAQLLADDFAKNGFKTVMPDYFNGDAVPIDALEPGRTFDFAGWL
PNHSSAHTRPSLDRVIAALKESGVTEFGATGYCFGGRYVFDLAFENVLKV
AVISHPSLLKFPDDFEKYATAVKAPLLINSCTFDQMFPKEIHEKTDEVFA
NFSPGYRREYWDGCTHGFAVRGDLSDPKVKAGKEGAFKAAAQWLLSHL
9baci-q2bcl3: Bacillus sp. NRRL B-14911 hypothetical proteinBacillus sp. NRRL B-14911 Show
MAEVLLLHHVLGRTKGIEAIADQLRDAGHTVHVPDLFKGRVFTSLEEGLA
FVKEIGFEEVTARGVRAATELSRDVVYAGFSLGVPAAQQLAQTREGARGA
LFFHACLPPSVFKSEWPADLPVQIHAMDTDPFFVEDGDIDAARELVASAD
HAELFLYEGREHLFTDSSLPSYDAVATKLVIKRVLDFLA
9bact-KP212148: Uncultured bacterium Dienelactone Hydrolase-like Promiscuous Phosphotriesterase P91 from Metagenomic Libraries, 1 reference(s), 1 structure(s).e.g. uncultured bacterium Show
MASWSHPQFEKGAMTARKVDYTDGATRCIGEFHWDEGKSGPRPGVVVFPE
AFGLNDHAKERARRLADLGFAALAADMHGDAQVFDAASLSSTIQGYYGDR
AHWRRRAQAALDALTAQPEVDGSKVAAIGFCFGGATCLELARTGAPLTAI
VTFHGGLLPEMAGDAGRIQSSVLVCHGADDPLVQDETMKAVMDEFRRDKV
DWQVLYLGNAVHSFTDPLAGSHGIPGLAYDATAEARSWTAMCNLFSELFG
9basi-a0a1y2fh95: Leucosporidium creatinivorum. Alpha/beta-hydrolaseLeucosporidium creatinivorum Show
MSLGKCCISGVKHEGTPVGSIVDYDGTAVYESFPSADYDKTKALLFLPDV
FGIGLNNGKLLADSFAAEGFAVYVPDYLNGDPIPEGALGSPDFDLGAWFG
KHGPDVTRPPLDKVIAALKAKGVTSFAATGYCLGGRYVADLVLEDVLKVA
VVAHPSLIKIPEDLEAIKKHSVPFLWNTCEVDSYFPPEAQAAADKVFADD
KNYKRTYWKGCSHGYSVRGDVSNPDVKAGKEGTFEASVKFLKENF
9basi-a0a221se81: Glaciozyma antarctica. Dienelactone hydrolase, 1 reference(s)Glaciozyma antarctica Show
MSAPTLGSCCIRGVSHEGTPKGTVTSFNGTPTYVTLPSGDYDKTKALLFC
PDVFGLELQNAKLLADDFAANGYATYLPDYLAGDALHKDALNDGTFDLMG
WLGKHPQSVTRPYLDALIAGLKEQGVKEFAATGYCYGGRYVFDLALDHII
KVAIVSHPSLLSVPEDLEKLKSVGTIPFLWNTCETDFAFGPEKQEIADKV
FADDKNYKRTFAPGCDHGFAVRGDLSVPAIKAGKEVAFEESVKWLQKHF
9brad-q35au3: Bradyrhizobium sp. BTAi1 hypothetical protein precursorBradyrhizobium sp. BTAi1 Show
MERRVSGTPTMFGTCRNRAASCARWRVRPRSRRAIAMAAVAVLAALGLTL
ANSASAQGITKDVPARVEMYPIASVTLSDRQFLSGDEGGTPVTVVGELRV
AQGSGRLPVVVLMHGSGGVGGNIAAWSRTFNAMGISTFVIDGFSGRGITA
TSTNQAQLGRLNLIMDIYHGLEVLAKHPRVDPERIVLMGFSRGGQAALYA
SLERFHKRWNRSGLQFAAYLPFYPDCSTTYRGDTELVARPIRIFHGGPDD
YNPVRTCKAFVERLKAAGRDVELTEYPDSPHGFDIGLLGANMLAISPKAQ
TVRNCRITEGEGGLLMNAETQQPFTYQDACVEFDPHVGGNPATAEAARQA
VTDFLRTLFKLS
9brad-q35jr7: Bradyrhizobium sp. BTAi1 hypothetical protein precursorBradyrhizobium sp. BTAi1 Show
MSPRLASRHHDCGTAPKSIGRLAMLTVLTTLWLAPAAAVQPDTVYFPSAD
GRAELTGYLFKPQGTGPFPAIVMLHGRGGPYSSNVNADCTLVSRAVPASP
CNAVTLSKRHVMWGNYWAEHGYLALLPDSFGPRGKAHGFGRGTHDDPDRA
DVNERTVRPLDAEGALAYLRQRRDVVPDRIVLQGWSNGGSTALNVLLRQG
LASTGFRGALIFYPGCGENSLLGPTLRSHVPVQLFLAADDEEVSPALCSA
MAERSRQVGTTIDTTIYPGASHGFDEPSASRQAVAGNGPAMDDTLRRAAP
LVVEWLKR
9brad-q35ma4: Bradyrhizobium sp. BTAi1 carboxymethylenebutenolidase (EC 3.1.1.45)Bradyrhizobium sp. BTAi1 Show
MGQDIKLAAADGFQLGAYRADPAGTPKGALVVIQEIFGVNHHIRNVCDRL
AAEGYVAVAPAIFDRIEPDFTSGYSPDEIAVARKFVANPDWPAMLRDTQA
AIDAVKDVAAVGIIGFCLGGSIAYAAATKLTGLKAAVGYYGGAIVRFADD
KPTVPTQLHFGEKDAGIPLADVDAIKAKRPDVEIFVYPGAQHGFGCDERA
SYDKPSADLAWTRSLAFFAQHLR
9brad-q35n34: Bradyrhizobium sp. BTAi1 carboxymethylenebutenolidase (EC 3.1.1.45)Bradyrhizobium sp. BTAi1 Show
MGTLISFKRPDGQEAKGYLAKAAQADAPGVVVIQEWWGLQDQIKGMCDRF
ALAGFNALAPDLYKGTVVPYHDTDAAGREMNSLDFMDATTQTVRGAAQYL
ARNGAKVGLTGFCLGGAVTIIGATRIDELTAGVVFYGIPPEQAAKPADVK
IPLQAHFANKDDWCTPALVDGFEAAMKAAGKSLELYRYDAEHAFVNEQRM
TVHDRAAAELAWGRATAFFHKHLG
9brad-q356t0: Bradyrhizobium sp. BTAi1 twin-arginine translocation pathway signal (EC 3.1.1.45)Bradyrhizobium sp. BTAi1 Show
MSVEPALTSDVIGLTKAAPFSRRGFMTASAAVTAGYTLAAGPVRAEVITT
DTNGLNAGDAKIKVADGEMPAYFARPASASNPPVILVAMEIFGLHQYIKD
VTRRLAKLGALAVAPDYYFRKGTDLTKIADIKELLPIVNAKPDAELLTDL
DATVAWAKSQGGDTSRLGIVGFCRGGRNVWEYAAHNAGLKAAVAFYGPLT
DAPNPLWPKNPTQLAPEMKAPVLGLYGEADTGIPVASVEAMKAALAENKK
TAEFKIYPGAPHGFHADYRPSYRKDAAEDAWAQMQAWFKKYGVLS
9burk-q4as89: Polaromonas sp. JS666 carboxymethylenebutenolidase (EC 3.1.1.45)Polaromonas sp. JS666 Show
MGQFIELKSADGFAVPAYVAQPDGKPRAAVVVLQEIFGVNSHIRAVADRF
AAEGYLAVAPATFARVKPGVDLGYTEADMAAGFELKTAVAALPGAGVLPD
IQAAIDHAAQASGGKVGIVGFCWGGLLTWHAACMLKGLSAAVAYYGGGIT
AEDEIARQPLCPVMAHFGDQDHWIPMEGIAAFTKAHPEVEVHVYAANHGF
NCDQRGSYNEAAAKLARERSLAFFAARLA
9burk-q4ayn9: Polaromonas sp. JS666 carboxymethylenebutenolidase (EC 3.1.1.45)Polaromonas sp. JS666 Show
MEITMLNNDQKNDFNALLPGQSSENGASRRTALKAALGVGYAATAMPIMA
QTAIKTPAQGLKTGETTYEVNGFKVPAFYAAPEGKTDLPVILVIQEIFGV
HEYIADTARRFAKAGYLAIAPELYARQGDPGSYNEMARLMTEVVARVSDE
QVMADLDGAVKWAGANGGNVQKVGITGFCWGGRITWLYAERSKNVKAGVA
WYGRLVGTPSALTPRHPVDLAASLKAPVLGLYGGQDGGIPLTTVNQMKDA
LAEAAARGNAAAKASEFVVYPKTPHAFHADYRPSYRKEAADDGFRRTLEW
FKARGVA
9burk-q44yv1: Burkholderia cenocepacia (strains AU 1054; HI2424) Burkholderia ambifaria AMMD carboxymethylenebutenolidase (EC 3.1.1.45)Burkholderia cenocepacia Show
MTAQWIDIPTGNDSFGGYLALPKRGKGPAVIIIQEIFGVNAHIRAVADQY
AADGFVALAPDVFWRTQPRVELTYEGADRDKGIELMKKTDVGLAVADIGA
AADALRARPEVAGKLAAIGYCFGGQLAYRAAATGKLDAAVSYYGGGIQNA
LDLAGQVTQPILFHYAENDHGIPLTAVDQVKAAFAGHGDASFHVYPGAEH
GFNCTDRASYNQRAAALAHGRTLTFLAEHL
9eury-c7dhl2: Candidatus Micrarchaeum acidiphilum ARMAN-2 Carboxymethylenebutenolidase, 2 reference(s)Candidatus Micrarchaeum acidiphilum ARMAN-2 Show
MRGKMTNGEMIKYASRAGEVAAYISKPEKTSKPAPGVILIHEIFGLSDHI
KDVADRLARAGYVTIAPDLFSIPEIAGVLTSENLSEAMKFMHTLPMEKMR
DTDYVAQALEKYETGNKQGLLAAMQMAFMGGMPKPKLVEEMKGAAAYLRS
LDGVNADKIGSMGFCFGGGMSILLACNEKIDACIIFYGENPDPISLVENV
KGPIMGIYGGKDIRISSNVDKLLSAAVQYNKAFEMKLYPEAAHAFFNDTN
ERTYNKAAAEDAWERVLSFFSKNLSSGQ
9eury-d6gve8: Candidatus Parvarchaeum acidophilus ARMAN-5 Carboxymethylenebutenolidase, 1 reference(s)Candidatus Parvarchaeum acidophilus ARMAN-5 Show
MEMKLKTLDIEYNTVDDKIKAYLVYPDNGKKYPGIVLIHEIFGLDEHTKD
VARRLALEGYVVLAPHLFSSKKLASVLTSENITETMKFMMSIPVEKQRDE
NYRAEALEKLEDSKKKAVMSVNEVLFIKRPNSLFTEYLSSGVDYLNSLDN
VNGKIGSAGFCFGGGMSINLGCTGKTDATVIFYGENPESIDSIKNVKGVV
MGLYGGEDMRIDAGIPDLAKALLDNKIPFTLRVFKGAHHAFFNDTRPQTY
NKSAAEKSWKMLLDFYKENLS
9flao-q1vvp0: Psychroflexus torquis (strain ATCC 700755 / ACAM 623) dienelactone hydrolase and related enzymePsychroflexus torquis ATCC 700755 Show
MENDGRTFYNFVVYPEVSQKAKVILVIHENRGLNDWARRFADEMAAKGFI
AIAPDLLSSTSENMSKTSDFENSDAARNALYELNSKQVTSDLDAVFDYAR
SIPAGNGEISVVGFCWGGSQSFSYATHNPDLEEAIVFYGTAPKDKADLAK
IQVPVYAFYGGNDARVNATIPKTEEGMNQLGNFYDYDIYLGGRHGFMRSG
AQPDASLENSQAREKAWDRLLKILK
9gamm-a0a346myw6: Solimonas sp. K1W22B-7 Dienelactone hydrolase family protein ScDLH, 1 reference(s), 1 structure(s).e.g. 7JIZSolimonas sp. K1W22B-7 Show
MRKQKIEYGNGPTQFHGWLIRDDSLDGVRPGVLVFPEAYGLNEHAIERAE
RLAQLGYVALAADMHGGGVVYSDTATLGPAIRSLFGDRAEWRARAQAALD
ALLAQPQVDRDRVAAIGFCFGGATCLELARSGAPLSALVTFHAGLQPPLE
ADAGRITGKVLICHGAEDPLMKPEALNAVLAELSRDRVDWQLLSFGGVAH
SFTNPDADARGAPGFAYNANADRRSWAAMQGLFAEVFAN
9gamm-m3DLH: Halieaceae bacterium m3DLH Dienelactone hydrolase family protein, 1 structure(s).e.g. 7JKAHalieaceae bacterium Show
MASWSHPQFEKGAMKHREIRYTDGHTQFVGELHWDEQQGGKCPGVVVFPE
AFGLNDHARERARRLAGLGYAALAADLHGDGRLIDDMEQLRPRMEGLFGD
RAAWRALARAALDTLVAQPEVDADRLAAIGFCFGGTTALELARSGASLGA
IVTFHAGLLPELPEDAGRIRGRVLVCHGAEDPLVQKEAIDAVMGEWRRDR
VDWQFTFYGNAAHSFTDPAADAHGMAGLAYEPLTEARSWTAMRNLFDEVF
SR
9gamm-q1ug92: Psychrobacter sp. PRwf-1 dienelactone hydrolasePsychrobacter sp. PRwf-1 Show
MSIKTYEIKTTADYGMELISYIALPESATDESSVPGILVAPEWWGVVEHP
REVTERLAKAGFAAIAMDIYGEGKLTTDAAQANEWMTQMLEDQDKLMGRC
RAILNDFADQLPVDGKRLGVVGYCFGGKIALDMAREGMPVKAVATFHGNP
TPKQPAEKGKFTAKALIAHGRDDSMVSMQAIDGLKQELDNAGVDYTVDVY
DDAQHGFTNPNADKRAEENGVDLGYNEKAANQSWDKMIDFMTANLK
9gamm-q2brl5: Oceanospirillum sp. MED92 hypothetical proteinOceanospirillum sp. MED92 Show
MWLITRSGGEAFEGYAAKASGASKGLVLVIHDWDGLTDYEVKRSEMLASM
GYDVFAVDLYGKGNRPVETGAKKAETGKLYKNRERMRSLILGGLNEARKS
GTQPTVVMGYCFGGAATLELARSGKADNIAGFSTFHGGLKTPEGQSYSGV
TAPIFVAHGGADAAIPMSDVAQLSVELEASKTPYEIQVYSGAPHAFTVIG
SKRYQQVADEQSWDAFSDFLKDTLGK
9gamm-q2zcl8: Shewanella sp. MR-4; Shewanella sp. MR-7; Shewanella sp. ANA-3; Shewanella bicestrii, Shewanella putrefaciens (Pseudomonas putrefaciens), similar to dienelactone hydrolase and related enzymesShewanella sp. MR-4 Show
MLVTQQTQDINTPTGPMRTYVYRPDAPGQFPCILFYSEIFQQTAPIARTA
TILAGHGFVVLVPEVFHELNPIGTVLAYDDVGKDKGNADKFAKPLEQHDS
DTQALIDFARQQSYCTGKVGSMGVCIGGHLAYRAALNPEILGAFCLYPTD
IHSNTLPCAYGNDSLSRSGDIQGELVLVFGKQDPHVSPEGRVLIHQQLMA
KNRNFSWLEVNAQHAFMRDEGERYDPALALQMYQQSVAFFHRVLR
9gamm-q3qhx3: Shewanella amazonensis SB2B dienelactone hydrolaseShewanella amazonensis SB2B Show
MRVCAEHHVINTATGPMGTRVYRPAGPGSYPAILFYSEIFQETAPISRMA
TVLAGHGFVVLVPEIFHELNPAGTVLGYDDMGKDKGNSDKATKPLESHDS
DTAAMVDFVRRQPWCQGKIGAMGVCIGGHLAYRAAVNPDVAAAFCLYATD
IHSGTIPSQPGNDSLSRTRDIRGELYMVFGKQDPHVPGEGRRLIQHNLEQ
HGVNHSWLEVNAEHAFMRDGDARHDPALALVMYQSAIALFQRTL
9homo-a0a0c9vhs7: Hydnomerulius pinastri MD-312. Unplaced genomic scaffold scaffold_10, whole genome shotgun sequenceHydnomerulius pinastri MD-312 Show
MSFCKNCITGVTHEGTPTGKNEVIAGVKCYVATPTIDYPKDKVVLFLPDV
FGIELVNAQLLADDFAKNGFKVVAVDYLNEDAIPSDAMNSGNFDLMAWLA
NHGADKTRPSLDKVIAALKEQGVTSFGSTGYCFGGRYTFDLAYDGVIKAA
VVAHPSLLKVPDDLEKFKGTGIPLLINSCTTDQQFPPESQALADKILGDG
SASAPKYKREYFDGCTHGFAVRGDMKDPKVKAGKEGAFKATVEFFLQHL
9homo-a0a0c9yug8: Pisolithus microcarpus 441. Unplaced genomic scaffold scaffold_137, whole genome shotgun sequencePisolithus microcarpus 441 Show
MSLCSDCVKGVHHEGTPEGKIEFIGDVRCYVGTPSGEYNKEKAVLFFPDV
FGIDLINSQLLVDDFARNGFKTIAIDYLNGDPVPDDAFDSGNYDFPAWLA
KHGNDQTRPNIDKVVAALKEQGVKEFGSTSYCYGARYGFDLAFENITKVT
VASHPSLLKIPEDLEKYKKLSRAPLLINSCTFDIRFPKEAQAEADKILGN
GEQFTETYRREYFEGCTHGFAVRGDLSIPEVKAGKEGAFKAAVLFFKKHF
9homo-a0a0d0bu71: Suillus luteus UH-Slu-Lm8-n1. Unplaced genomic scaffold CY34scaffold_3, whole genome shotgun sequenceSuillus luteus UH-Slu-Lm8-n1 Show
MSFCKHCIQGVRHEGEPLGKLETIAGVACYIATPTVDYPKDKVVLFLPDV
FGIELNNAKLLADDFAKNGFKVVAIDYLNGGSLAADAMNSPSFDFMGWLA
NHGADQTRPPLDKVIAALKAEGITKFGATGYCFGGRYVFDLAFENIIQCA
VVSHPSLLKVPADLEAYFTKSQAPLLINSCEVDQMFPAEAQAKADEIFGD
GKFAPGYKREYFPGCTHGFAVRGDMKDPLIKAGKEGSFKATVEFFLAHL
9homo-a0a0h2rnr5: Schizopora paradoxa. Alpha/beta-hydrolaseSchizopora paradoxa Show
MSFCDKCIAGVRHEGTPSGKVEEINGVKTYVAIPEKEFPKDKAIIFCSDI
FGLDLPNNLLLADDFAKNGFQVYIPDYLNGDPVPGDFLGGKFDLNKWFPT
HTAEFTRPPLDKVIASLKEKGVTTFGAIGYCYGARYVFDLAFDRVIKAAV
VNHPTFIEAPKDHEEYKAKAAGIPLLINSCETDSQYPAEKQEIGDKVLGG
GTMKGEGYERLYWPGCEHGFSVRGDMSKPEVKAGKEGAFKAAVEWFIKYL
9homo-a0a1b7n852: Rhizopogon vinicolor AM-OR11-026. Alpha/beta-hydrolaseRhizopogon vinicolor AM-OR11-026 Show
MSFCKHCIQGVRHEGEPQGKLETIGGVPCYVATPTVDYPKDKVVLFLPDV
FGIELINAQLLADDFAQNGFKVVAMDYLNSDFIPADAMNSGTFDLMAWLA
RHGADKTRPVLDKVIAALKEQGVTKFGATGYCFGGRYTFDLAFDNIIQCA
VVAHPSLLKVPEDLETYLAKSKAPLLINSCEVDQMFPKEAQEKADEILGA
KFAPGYKREYFAGCTHGFAVRGDMTNPLIKAGKEGAFKATVEFFLANL
9homo-a0a1j8qkk7: Rhizopogon vesiculosus. Uncharacterized proteinRhizopogon vesiculosus Show
MSFCKHCIQGVRHEGEPQGKLETIGGVPCYTATPTVDYPKDKVILFLPDV
FGIELINAQLLADDFAQNGFKVVAMDYLNGDFIPADAMNASLAQYPSGTF
DLMGWLAKHGADKTRPVLDKVIAALKEQGVTKFGATGYCFGGRYTFDLAF
DNIIQCAVVAHPSLLKVPEDLETYRAKSKAPLLINSCEVDQMFPPESQAK
ADEILGANFAPGYKREYFPGCTHGFAVRGDMANPLIKAGKEGAFKATVEF
FLANL
9homo-a0a286uk81: Pyrrhoderma noxium. Alpha beta-hydrolase, 1 reference(s)Pyrrhoderma noxium Show
MSFCKDCISGVTHEGEPTGKFEEINGVKTYVALPSTDYPKDKAILFLTDV
YGLSLVNNLLLADDFAKNGFQTYAPDYLNGDPITVLDGTFDIGTWFKTHG
PEHTRPTLDKVVAGLKERGIKVFGATGYCFGARYVFDLAFDNEIKAAVVS
HPSLLQAPEDLEKFKLTGVPLLINSCETDSQYPAEKQKIGDDILGGGKPE
AENYKRAYFPGCTHGFAVRGDLSIPEVKAGKEGAFKNAIEWFIKKLSNVN
IVIPKSRI
9homo-w4jqh1: Heterobasidion irregulare TC 32-1. Uncharacterized protein, 1 reference(s)Heterobasidion irregulare TC 32-1 Show
MSFCKDCISGVRHEGTPEGKFETIGGIRTYVAKPTVDYPKDKAILFLTDV
FGPELQNSLLLADDFARNGFQVYLPDLFGGDPVPVDALNPGSNYDIMKWF
PNHGQAQTRPVIDAVVKALKEQGIAAIGASGYCYGGRYVFDLAFDGVTAV
SVVAHPSLLQLEDLDKYAASAKAPLLINSCEVDTQFPAEKQAKADAVLGD
GKFAPGYLRTYFDGCTHGFSVRGDMSDPKVKAGKEGAFKSSVEWFLKYL
9micc-q4ndv9: Arthrobacter sp. FB24 dienelactone hydrolaseArthrobacter sp. FB24 Show
MTIIDLSGAGSTAATPSGAAGTGSPNLRGYLAEPPGPGPFPAVLMIHEAF
GLNDISRRQADRLAAAGYLTLAVDLFSNGGMRRCIVSTMRSMASGSGQAF
TDLAIAQAWLEKSGRTNGKVGVIGFCMGGGFALLLANKGFDAAAVNYGRL
PKNPEDALAGACPVVGNFGNADRSLPGAAAKLEATLENLGIEHDIKEFDG
AGHAFMNDAEEGPRLLRPLFRVMGIKPDPDAAAEAWQRIEDHFARYLKG
9pezi-q6q6n9: Chaetomium globosum dienelactone hydrolaseChaetomium globosum Show
MASNPPGKCCTVGVKHEGDTVGKTIQVASKHDAYLATPPPDKAHQGVGIL
LIPDVIGIWQNSKLIADQFAANGYLTLMLDVYNGDALSLTSRPAGFNLFD
WIAKGSDGKNPHTTEAIDPMVVDGIKALKEEYGIQKMGGVGYGLGAKYVI
RHYKNGISAGYVAHPSLVDEEELAAIGGPLAISAAETDSIFPAEKRHRSE
VILKDAGKPYQINLFSQVEHGFAVRWRHVRQGPEVSKEQAFLQAINWFDE
YLL
9prot-q2z095: uncultured beta proteobacterium dienelacton hydrolase, 1 reference(s)uncultured beta proteobacterium Show
MWWCVRARYAFRSFNQETPMKTALALSLLFLSSSAMAAVVVKDVSYKAGE
TMMKGALAFDDTAKDKRAGVLVVPEWWGANDYARKRARMLASEGYVALVV
DMYGNGQIADNPTEAGALAGSINKNPPLALLRFLAAEKFLSAQPNVKKGE
LAALGYCFGGGVVLNMARAGVPLKSVVSYHGVLATDVSVKPGDIKAKIRV
FHGEADPVVPPAQVEAFKFEMDNAKADYMFVSYPGVKHTFTNREADSYAA
QFGLPLKYDHAADTDSWTRTLEFLKSTLNQQP
9prot-q3xmy7: Magnetococcus sp. MC-1 dienelactone hydrolase precursorMagnetococcus sp. MC-1 Show
MRTYAKWMGVALALLWSVPAWAVVQEQEVPYKDGDTGLAGYLVWDDAFSG
KRPGVLVVHEWWGLNSYAKSRARQLARMGYIAFAADMYGEGHVTEHAKEA
KGWMQQVTANVEGWRRRADLALEQLKAAPQVDTTRLAAVGYCFGGGTVMQ
MAYGGSDLLGVASFHGPLPPAEKKDYAKIKAKIFVAHGDADTFVPLERLE
AFRIGLNEAGADWQLLRYGGAVHSFTNPAADGSWMPTVKYDAKADHRSWA
AFTHFLDELFWP
9rhiz-q3wwa3: Mesorhizobium sp. BNC1 twin-arginine translocation pathway signal precursor (EC 3.1.1.45)Mesorhizobium sp. BNC1 Show
MSKPQITQAMIKAYDEYTHLTLDRRGFMEKLTKLAGSSAAAVAIAPLLAA
NAARAAIVPEDDARLNAEDVTYPGAEGEMKGYLVRPADAQGPLGAVIVIH
ENRGLNPHIRDVARRVALEGFVALAPDFLSPQGGTPENEDEARQLFSQLN
PDQAVANGVATITFLENHDGTNGKVGAVGFCWGGGTVNALAVNAPSLDAA
VAYYGSQPDPEQVEEISAPLLLHYAGLDERINAGIETFRSALDAAGKEYT
IHMYEGVNHAFNNDTSEARYNKEAADLAWDRTIAFFKEKLA
9rhob-q2cfj5: Oceanicola granulosus HTCC2516 hypothetical proteinOceanicola granulosus HTCC2516 Show
MRVMQKITLDGPDPVMIHDMLGETPPPKIAVEAELYLPEGPGPHPGVVVS
EGLGGLQDKRERDYGRMLAEAGYAVLVVDSFGTRGYGDNGDFVRAMKVTE
AMMLGDAFTALAALAARDDVDAGRIGIIGFSYGGMITQLAAYEQLARAYL
GAHGPRFACHVSYYGCSIPRLNDPATPGAPVTILLGGLDRNVDIARAEAI
GDDLRRGGSDVEVIRYDGIYHQWDGTDETRRWVPANLRYLHLRLDRDYGI
HDERGRMKMRGRWSRRAVILRHADPRGYHILRDRETTKKTNDLLLARLQA
M
9rhob-q3qxu2: Silicibacter sp. TM1040 dienelactone hydrolaseSilicibacter sp. TM1040 Show
MKSEAFHYGDGIDQFVGHLVCDDSREEPAPCVLIAPAFGGLSDFERARAE
DLAKLGYVALAVDYYGDGKRAASPEEAQHLMAGLQADRTVLARRMGAALE
AARALPQVDAGRIGAMGYCLGGKAVLDLARTGADLRACVPLHGVYDRPNF
ETQTMRAAVLVLHGWDDPLAPPSALEALAAELNEHCADWQVLGFGHTGHA
FTNPNAKDSAGGMIYSATASSRAWTALTGFLAETFEGAASA
9sphn-q1n7l4: Sphingomonas sp. SKA58 dienelactone hydrolaseSphingomonas sp. SKA58 Show
MTGLSPKDARAINVRPVDYVADGLAMRGHLAIPADAGPHPALLVFPEGYG
LSDQAILRAERIASEMGYVALACDLHGEARELSGLEEVLEKLEPLQKSSA
CVRERVVPAYDALLAQPEVDPAKVGAIGFCFGGTMALELAFTGRDIGAVV
GFHSGLALTAPQDAPNIKAAILLLLGADDPSIDAEQRLLFEQTMRQAEVR
WEMHVYGGVRHSFTNPRAHERGLPDWLRYDPIADRRSWNAMRAFLGELWA
APDGGTSVKTAMP
9sphn-q1ncg2: Sphingomonas sp. SKA58 dienelactone hydrolase family proteinSphingomonas sp. SKA58 Show
MTITRESLVHEIDGEPFEHMVVADPKAGRRPGVLLFPNVLGAKDADFAYA
QKVAELGYSLLVVDLYGQGKRTTRAESDAARYMNALRDDRALLRDRVNAA
HMVLKGLDMVDADRTAAIGFCFGGLCVLDLARSGADIAGGVSFHGVYDPP
PFPYAAISAKLLVCHGWDDPIAPPEATMGLARELTEAGCDWQIHAYGHTG
HAFTDESANMPDKGLAYSPAADRRSFQAMTNFLSELFD
9sphn-q1ndd5: Sphingomonas sp. SKA58 carboxymethylenebutenolidaseSphingomonas sp. SKA58 Show
MGAFIPVDTLDSDAQFDAYVAKPEGEAKAAIIVIQEIFGVNEGIRRKCDG
WAKAGYVAYAPDLFWRIDPHIELDPDVPDEMDQALGLMPKFNQDQGIRDL
EATIKAARVAAGGGKVGLVGYCLGGRLAFMAACRTDGDAFVGYYGVGIDG
LLGEQHAIGKPTMLHIPTADHFVTPDVQKAMHEGLKDNVHVTLHDYEGLD
HGFATEMGQRRNDAAAVLADGRTADFFAEHLS
9sphn-q1ni32: Sphingomonas sp. SKA58 probable dienelactone hydrolase proteinSphingomonas sp. SKA58 Show
MGSISEKGERTKKARAFCFQARTGASYEFAWARGCPDPQGKGATVKEDGM
NDFDVTAAKKAADYPRKVLDLFDAYVHGALDRRGFLNQCATHVGGMISAT
AVLAALSPDFARAQVIAADDARIESRWIEVPSPQGYGMIRAYVARPADMG
SAALPVVIVAHENRGLNPHIEDIARRLALEGFMAVAPDALTTLGGYPGDE
DKAREMFATLDREKIGEDFVAAANYARTMSGGNGQLATIGFCFGGGIANL
LATRLPDLKAAIPFYGSPPPLADVPNIKAELLIHYAGNDARINATWPDYK
AALDKAGVRYQAFVYDSVEHGFNNDTTPRFDKAAADLAWARSLTLLRQST
R
9sphn-q2n5n6: Erythrobacter litoralis HTCC2594 putative hydrolaseErythrobacter litoralis HTCC2594 Show
MCDERDFAEWDRKIAAKGLSRREFGALTGAAALAACAGGETVAVEASMDA
SGLVENRVLIDTEDGEMDAFFVHPSAGKYPAVIVWPDIASLRESKRNIAR
RLAGQGYAVLVANPYYRDVPGDRFESSVQFREAGGFQLVRPWREKLSSDA
VMRDADALVSWLDGREAVDSERGIGTQGYCMGGPFTVYTAHSRPDRVKAA
ASFHGGGLVREDEDSPHKILEDGTSYLFAIAQNDDERDPDDKTALREAAE
AAGVDAEVEVYAGDHGWTVPDNPAYVEGPAEKAWSRLLALYEEAL
9sphn-q2n6j1: Erythrobacter litoralis HTCC2594 carboxymethylenebutenolidaseErythrobacter litoralis HTCC2594 Show
MTAQVTIPSHYGDHDFSAYVARPEGEPKAAIVVIQEIFGVNAGIRRKCDL
LAEQGYLAVAPDLFWRLKENIELDPDIEPEFQQALDYMGKFDPDGGVRDI
ESTIKWARAETGGKKVGAVGYCLGGKLAYMTAARTDSDATVGYYAVGVPD
MLNEAHAIANPLMLHIPTEDGFVDKDAQKAMHDGLDDHPKVTLHDYPGLD
HGFATEFGKRRDEAGAKLADERTDGFFAEHLA
9sphn-q3v9g2: Sphingopyxis alaskensis RB2256 carboxymethylenebutenolidase (EC 3.1.1.45)Sphingopyxis alaskensis RB2256 Show
MRGKSMGEMIRMTMDDGAAVAVYHAQPVGERRGGLVLVQEIFGVTDHIRE
LCDEYAADGYEALAPALFDREHPGFESDYSGPQFERAVQLARELHPFEQS
LKDAQTCIDALKGKGPVFITGYCYGGSVAWRMAQISPDLAAASAYYGSLV
PTMFSDEPPRCATIAHFGRFDGGIPMEGVEALIAKNHPTAQIFVYEAGHG
FNSDRRKDYHEPSADLARERTLMLFRACGG
9sphn-q5yb90: Sphingomonas sp. tfd44 tfde2, 1 reference(s)Sphingomonas sp. tfd44 Show
MCHIEGCSSFPSGDAGALFQDGEISGYRFGEDASDRRIAVLPDIYGCTSF
YRGFAAHLAARGAVVDLIRTFEDIGKLAEHTREAAFERRHRLKDRTFVDA
FERYARRRGIGGVVGFCIGGLFVYELARRNLPAALVSFYGFPQGLPNQEA
VDVPLTYLDTVTTPHLTLFGSEDDLISEEVQTQLADIGERQPACQVRVFA
GSGHGFLTDLDGVDAGRRDNAAKALALCEEALFAAARATA
9sphn-q5yb97: Sphingomonas sp. tfd44; Sphingobium herbicidovorans tfde, 3 reference(s)Sphingomonas sp. tfd44 Show
MCHGQASAALPPPGEYVAMNDGLPSLAFGDEGERVRIAILPDIYGAGPFY
QQLATHMAERGAFVHLMDPFHELGPLPEVTREAAFARRHRVRDRAYVDAF
AHFIGEQRITGVAGFCLGGLYVFELARRGIPVSLVSLYGFPQGLANDDPL
PVPFDYLEGLPHRHVALFGDQDQSQSPENFLRLTEIAERTPDFGLHLFPG
SGHGFLADIGSDDPSLAQNARAALEIVEEVLLVGEAKERD
9zzzz-g3crd8: environmental samples uncultured organism DLH domain-containing protein, 1 reference(s)uncultured organism Show
MSIRGLFGSLLVTLTVAGTNVSAGEFVDVAGGTRAEPVRLIGYMARPPGP
GPFSAVVLLHGCGGFHSSMISWADRLSRFGYAALAIDSFGPRGIDEDCGS
FFPHQTADGYAALSYLTGKPFVRASHVAVMGFSQGGGAVLAALEKGPVEQ
RYPEKFRAGIAFYPPCRFASGITTGPTLVLIGNADDWTPASACEAMAAGR
TEFGAPRTPGDRSLVELVIYPGVHHSFDVLDLSLAPTRGTTAHGHRVEYN
EEATKNAIVRVRDFLQRTIGAP
aciad-q6f6s6: Acinetobacter sp. (strain ADP1) hypothetical protein, 1 reference(s)Acinetobacter sp. Show
MMHTRIPQMTANITTREIEYTANDGTSFIGYFAAPANGQPVAGILVAPEW
WGRTDYTLQRARELAEHGYAALAIDMYGDKKVTSTVAEASQWMNQTFEDP
DTIVNRASAGLKTLAAQPEVDPERLAAIGFCYGGKVVLDLARSGADLKAV
ASFHGTLAPKAPAKKGQIQGEILVLHGEKDSMVTLEDVAKFKEEMNNADV
NYNVIVFEDAKHGFSNPLADERAKANGVDLGYSATAEQQSLAAMYSLLER
TLSI
aciad-q6f933: Acinetobacter sp. (strain ADP1) hypothetical protein, 1 reference(s)Acinetobacter sp. Show
MITARVRSGVGEMAGQYIEVKTQTGTSFVAYLAVAEGGRGPGIVLCQEIF
GVNAAMRAKADFLAEEGYTVIVPDLFWRTAPRIELGYTEQDFQKAFELYQ
NFDENLGVEDIRETLNYLKTLASCDADAGLGVVGYCLGGKLAYLAGCRIP
EVACAVGYYGVGIEKALDELANVKGRMVLHIAELDKFTPPEARQQILDAA
AQYNNVNAYVYEGVDHAFARPNSEHYHKPSARFAHERSVTALHQTIG
acic1-a0lut5: Acidothermus cellulolyticus (strain ATCC 43068 / 11B) carboxymethylenebutenolidase (EC 3.1.1.45)Acidothermus cellulolyticus 11B Show
MPYDAFLAETVTIHGHGGDAIEAYAARPLRPEPRGGVVVIHHMPGYDRAT
KEITRRFAEAGFNAICPNLYSREAPGAAPDDAAAAARARGGVPDDRLVGD
VAGAATYLRELSNANGKVGVIGYCSGGRQAVLAACSLDINAAVDCYGAFV
VSPPPPGAPLAVRPLTDELPKLRCPLLGLFGADDAHPSPAETAEFEKILA
EHGKTYEFHTYNGAGHAFFAVDRPSYRPEAANDGWQRILEWFQRYLATGA
acic1-a0luv7: Acidothermus cellulolyticus (strain ATCC 43068 / 11B) carboxymethylenebutenolidase (EC 3.1.1.45)Acidothermus cellulolyticus 11B Show
MEVHRVLLDGEDAPVPAYEAVPADRRGGIIVVHEAFGLTDYIRGVCAALA
EDGFHAIAPNLFHRHGIDAISYDDLNKAKDVMAQLAADQIRADIRSAVQR
LGAAGLTDRSVGILGFCMGGSIACAVATEQAFGAAVTFYGAGIRQGRFGF
APLADRVPLLRTPWLGLYGDRDTTIPVADIEFLRSEAARAPVPTAVVRYP
EAGHGFHCSARPAHFHQPSAADAWERTRDWFNRYLNPAGLPTGPAG
acicj-a5g0j7: Acidiphilium cryptum, Acidiphilium multivorum, dienelactone hydrolase and related enzymes-likeAcidiphilium cryptum JF-5 Show
MTDKITTTIGSIDIKAADGSGAFKAYTVTPSVKPTGAVVVIQEIFGVNDA
LRATCQEIAEMGFIAIAPDLFWRQEPGVDLTDKSEAEWKRAFELMNGFDQ
DKGIEDLKTTLATARALPGCNGKVGTVGFCLGGRLAVMMATRSDADVNIS
YYGVMLDKLIPEFGNIGRKLVMHMAELDEFAPKEARDAVMAATKGNALVS
SHVYPAVHHAFARVNGVHFDRRAATIANGRTAEALVEALS
acicy-q2d8c8: Acidiphilium cryptum JF-5; Acidiphilium sp.putative carboxymethylenebutenolidaseAcidiphilium cryptum JF-5 Show
MGEMINLTASCGHKFQAYAAGDTASQRGIVIVQEIFGVNSHMRQISDHLA
SFGYRVVTPALFDRVERGVELGYDAAGRDKGLALRAEITDEAVMRDIEAS
AAALSPRPTGIIGYCWGGTIAWWGATRSKSFKAAIGWYGGGIAATRSEKP
NCPVQLHFGAEDKGIPLADVESIRKAQPDVGIFVYPGAEHGFGCHDRPSF
NPRANEIAEHRSLAFFAEHVV
agabu-k5wys0: Agaricus bisporus var. burnettii (strain JB137-S8 / ATCC MYA-4627 / FGSC 10392) (White button mushroom). Uncharacterized protein, 1 reference(s)Agaricus bisporus var. burnettii Show
MSLCKDCVRGVSHEGTPGGQNTVVNGVAVYIAKPTVDYPKDKAVLFLPDV
FGKELVNAQLLADDFARNGFYCVIPDLFNGDALPPNAMNEPGFDIMKWFP
NHGPEQTRPTLNKVMIGLQEQGVKEFAAVGYCFGGRYVFDLAFENLIKVA
AVCHPSLLKIPADLETYLNKSKVPLLINSCTVDSQFPIPAQEQADQILGN
GKFEPGYKREYFDGCTHGFAVRGDLSDPKVKAGKEGAFKATVEWFFKYI
agrtu-ATU3651: Agrobacterium tumefaciens (strain C58 / ATCC 33970) hypothetical protein atu3651, 2 reference(s)Agrobacterium tumefaciens Show
MICKSFAALLAIVTVVTTSIALPSAANEVRFTSDAGKPSAFREKLARQRG
ETLPPYQGVPLVGFLSRPKGDGPFPAIVILHGCGGLGPRLKDDVSGRLVS
QGYVVLVVDSFATRQMKSTCATTERDVVFTISDRVYDAYGALDFLSKEPF
VDASRVALMGFSAGGVTALTATKSGGVEQLQDKKFKAAIAYYPTCSATDG
EATVPTLIMAGELDDWGPPAKCRQRLANLSEKGSEIRLIVYPGAFHDFDV
PAAKPGTVYFGHRLEYSASATAQANKDVDSFLRQELRN
agrtu-DLHH: Agrobacterium tumefaciens (strain C58 / ATCC 33970) carboxymethylenebutenolidase, 2 reference(s)Agrobacterium tumefaciens Show
MISSIAWKRARSTAVSSWISPPDVKPGCGAHANVWRRFRPPCSAKGDLRY
PPFASGFKEERAMDKPKITQAMIDAYDEYTHLSLDRRKFMEKLSLLAGSG
AAAAAIAPLLSANSARAAIVAPDDAGIVAEDVTYPAPGGEMKGYLVTPKS
VSGPIGSVIVIHENRGLNDHIRDVARRVALAGFRALAVDFLSPQGGTPSD
EDKAREMFSGLDMEATVANAEAGRVWLAARQGANGKVGAVGFCWGGGLVN
RFATKSAGLNAGVAYYGQQPPVADVRDIKAPLLLHYAGLDERINAGIDAY
KKALEANGKTFEIFVYDGVNHAFNNDTSSARYDKAAADLAWGRTTDFFKK
YLA
alceu-CBNC: Alcaligenes eutrophus Cupriavidus necator (Ralstonia eutropha), Pseudomonas chlororaphis (Pseudomonas fluorescens) Achromobacter xylosoxidans, Comamonas acidovorans, Pseudomonas aeruginosa, Bordetella petrii Delftia acidovorans (Ps. acidovorans) (Comamonas acidovorans), Bordetella sp., Ps. nitroreducens, Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans) dienelactone hydrolase (EC 3.1.1.45) tfdE tcbE, 9 reference(s)Ralstonia eutropha Show
MLTEGLSIDAKGGGRFGAHLQLPARGRGPVVIVAQEIFGVNPFMTEVLAW
LASEGFVGLCPDLYWRHGPGIEFDPNDEVQRARALGMFRDYKLEDGVADL
RATVAYAASQPFCDGGVAVIGYCLGGALAYEVAAEGFAQCCVGYYGVGFE
KRLERARLVKTPSMFHMGTNDHFVTAEARQLITNAFEANPAIALHWYDAG
HSFARASSPNFSPEATRTANARTLEMLKRMKPIGTIGQ
alceu-tfe1: Alcaligenes eutrophus (Ralstonia eutropha) ( and strain JMP134) (dlh I), 3 reference(s)Ralstonia eutropha Show
MLSDGVEITSRSGGRFGAYLGKPTTDSAPIV