9plat-a0a1i8gq29

Macrostomum lignano. Carboxylic ester hydrolase

Comment

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MLRIGLLPQWLLVAAAMSAVLLQPMGSEAQAAAPRHTVNL
TNGSSIQGFT STVRSRTVWSYLGIPYAKPPVGALRFKPS
VPLDSPIGNSSLPYDASKKPK ACYYWPLSPQEFEKTNPA
LMMWWNNTEMSEDCLYLNVWSPTSDSAAGKAV MVWIYGG
GFFGGSSSLEVYDGAVLAATGDVVVASMQYRTGALGFMFL
DDT EAPGNAGLYDQYRAIQWIHENIRAFGGDNSQITLFG
ESAGAVSVSYHLLS PYTQGYFRRAILNSGSAIAWWASES
RSTGWSKSLALADLAKCRPGNTRDG IRIANCLRQVTPEL
LQQQTWNAMSDTALFFDVPFKPVFGSDFLPKMPAEQ LRD
SKMNNDVKKADLLLGVVKDEGAFWIMYALGGIFMHKNGNW
NIPFWWG QPLDQQLNRDYDFLVQNRTGLDMDKDPYNLVA
RYFIVNNTHLDSLVTEAV SFEYQVPSKLFGRTSWTAKET
LDALDDLTSDRSFKCPTVDFAEMYAQMLG TNGSNSIWMY
SFEQRSQMLPLPEWTGVMHGYELDYVFGTPFNQRFGTEFY
NFTTSESQLSDDVMKFWTNFARTGNPNQFNSSSLSGEAW
PAYNLSDRSYI VLKSRPSTASSFRIGQNLRKRQCDFLRY
QVPNIVRQIGARYDCSSDRRSE PTMGPASSANALQGKLA
VIILVAGLVQLSLL

References

Title : Genome and transcriptome of the regeneration-competent flatworm, Macrostomum lignano - Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
Author(s) : Wasik K , Gurtowski J , Zhou X , Ramos OM , Delas MJ , Battistoni G , El Demerdash O , Falciatori I , Vizoso DB , Smith AD , Ladurner P , Scharer L , McCombie WR , Hannon GJ , Schatz M
Ref : Proc Natl Acad Sci U S A , 112 :12462 , 2015
Abstract : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
ESTHER : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedSearch : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedID: 26392545
Gene_locus related to this paper: 9plat-a0a267ec96 , 9plat-a0a267e1q9 , 9plat-a0a1i8i888 , 9plat-a0a1i8i7g4 , 9plat-a0a1i8gq29 , 9plat-a0a1i8h217 , 9plat-a0a1i8g0z8.1 , 9plat-a0a1i8ggj9 , 9plat-a0a1i8gre8 , 9plat-a0a1i8hbi6.1 , 9plat-a0a1i8isp7