9plat-a0a1i8i888

Macrostomum lignano Uncharacterized protein

Comment

Relationship

Family : Cholinesterase-like

Block : C

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

KALVDILVFAQRRIWFHKNYFWKRHSIPAISMASTLTTLL
LLLALSAAAV SAQRNFTIVRYLNVTTTQGPIRGAVIETK
GSGDKNMVHIGSFLGINFAKV PTGEFRFAHPVFTKWDFV
QDVLDFDRRCYQDPGASGDYQTMSESCIAANI WTPYNGT
SSNPGSYPVLVWIHGGRFETGSIIEEINSGRVLTAHESIV
TVS LQYRLGVLGFLRLSSTVAPGNMGLKDQALGLEFVHK
NIERFGGNLQTVTL MGLDAGAAAVGYHMLNDNTKTYFKR
AVMLGGSPMVFWSVRQSTTDVERLH AKFAREKLNCDPDR
LGLDEALKCLREVGPEALINAQKEFIKDFQGIEFPP VID
GDYIKEDPVVALRGLRFEPKQLIIGFTNSEAATYVESSLR
DKGWSKE DLQDPAKYRSVIEDNFRTYEREPDIMSTAARK
FMTDRFTSFSNPSAEVNF RRWLDAASDRLFVCAANEFAD
LSTRVTGQSVDVYFYVFSEQDNTPNYVGA SHGSDAYYFF
GNPTDDAPIVSPEQAQLSVRMMDYLSRFVATGDPVPRDND
RVWAKFNISQKYYHNFTADSSAGYNIKYGFHRDDCGFWD
KTLKYVNSLQS TALAPAPEDVPKVRVVRDVHTNLTLNEA
GICDNVVNATTLAIMIPLLISN VALLGALVWLLIKYNSL
G

References

Title : Genome and transcriptome of the regeneration-competent flatworm, Macrostomum lignano - Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
Author(s) : Wasik K , Gurtowski J , Zhou X , Ramos OM , Delas MJ , Battistoni G , El Demerdash O , Falciatori I , Vizoso DB , Smith AD , Ladurner P , Scharer L , McCombie WR , Hannon GJ , Schatz M
Ref : Proc Natl Acad Sci U S A , 112 :12462 , 2015
Abstract : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
ESTHER : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedSearch : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedID: 26392545
Gene_locus related to this paper: 9plat-a0a267ec96 , 9plat-a0a267e1q9 , 9plat-a0a1i8i888 , 9plat-a0a1i8i7g4 , 9plat-a0a1i8gq29 , 9plat-a0a1i8h217 , 9plat-a0a1i8g0z8.1 , 9plat-a0a1i8ggj9 , 9plat-a0a1i8gre8 , 9plat-a0a1i8hbi6.1 , 9plat-a0a1i8isp7