9plat-a0a1i8isp7

Macrostomum lignano. Uncharacterized protein

Comment

Relationship

Family : Pancreatic_lipase

Block : L

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MTTTLCLILALVASLAAALPQPQEVKEPKTASNEAMLIPM
EVCYDGLGCF STGGNFYDLVRRPLQLLPQSPERIGPTYA
LYTRRSIISGQSLVYGDKSSV EKSNFDASRPTKIIIHGF
LENGSEDWVNDMKKALLLHGDYNVIQLDWSRG NQLPYTQ
ATANTRVIGAMIAQMIVWLEAEFGASRTSFHLLGHSLGAH
VSG YAGERLPGLARITGMDPAGPYFEGTHPEVRLDPTDA
NFVDAIHTDGDSLL SSAKLEGGFGMMEPAGHVDFYPNGG
KKQPDCKQNPIISIIINGIVEGSKW AVACDHLRVLPLMT
STVMHYQGDYKAYPCDSYENFKAGRCATCGSTGCAF MGM
RADEWRPPTGTSGVRMFLDTTGSEPFDIHHYAVSVSISDV
SDAKKQY GDLYLILESETGERSSELTVFSKEYMYPGDRR
TALMTSPDSVFNLARITV SWKHRWVLAILTQRLRINRIE
IFEGLTEKRSLFCARDVSIDSGKSITLGR SNAC

References

Title : Genome and transcriptome of the regeneration-competent flatworm, Macrostomum lignano - Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
Author(s) : Wasik K , Gurtowski J , Zhou X , Ramos OM , Delas MJ , Battistoni G , El Demerdash O , Falciatori I , Vizoso DB , Smith AD , Ladurner P , Scharer L , McCombie WR , Hannon GJ , Schatz M
Ref : Proc Natl Acad Sci U S A , 112 :12462 , 2015
Abstract : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
ESTHER : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedSearch : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedID: 26392545
Gene_locus related to this paper: 9plat-a0a267ec96 , 9plat-a0a267e1q9 , 9plat-a0a1i8i888 , 9plat-a0a1i8i7g4 , 9plat-a0a1i8gq29 , 9plat-a0a1i8h217 , 9plat-a0a1i8g0z8.1 , 9plat-a0a1i8ggj9 , 9plat-a0a1i8gre8 , 9plat-a0a1i8hbi6.1 , 9plat-a0a1i8isp7