9plat-a0a267e1q9

Macrostomum lignano Uncharacterized protein

Comment

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MSIGVLPQLLIVAMAAVLLQSMSSEAQAEVTRHTVNLSSG
SSIQGFTSAV RNRTVWSYLGIPYAKPPVGPLRFKPSVPL
NEPVGNSSVPYDASKKPNSCY YWPVDQRETNPAMMVWQN
NTEMSEDCLYLNVWSPTSDATANKTVMVWIYG GGFFSGS
SSLEVYDGAVLAATGDVVVASMQYRTGVLGFMFLDDTEAP
GNV GLYDQYRAIQWIHQNIRAFGGDESQITLFGESAGAA
SVSYHLLSPYTQGY FRRAIVSSGSAIAWWASESRGTGWS
KALALADLVKCRPDDTKDGIKIVNC LRQVTPELLQQQTW
GAMSSVLKERNQSYSRYHQQNLKRYQESGNSIAFAA SQT
SLYMDVPFKPVFGSDFLPKMPEEQLRDSAKNNDVKKADLL
LGVVKDE GVFWVMNALGNIFALGIIPFWWGHPLTKEQNA
SYDYSVTNFPGLDLDQDP YNLVARYFIVNNTYLDSLVTE
AISFEYQVPSKLFGRTSWTAKETLDALDD LTGDRSFKCP
TVDFAEMYAQMLGTNSSNSVWMYSFEQRSQLMPLPEWTGV
MHAYELSYVFGSPFNQRFKEAFYNFTTSDAQLSDDVMKF
WTNFAKTGNPN QKLSSAWPAYNLSNRSYIVLKSRPSTDW
TFQVGQNLRKRQCDFMRYQVPN ILRQKSARYDCPSDRGN
KPTMGPTSSANDLSGGQGKFALILVVGLVKIFL HALAT

References

Title : Genome and transcriptome of the regeneration-competent flatworm, Macrostomum lignano - Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
Author(s) : Wasik K , Gurtowski J , Zhou X , Ramos OM , Delas MJ , Battistoni G , El Demerdash O , Falciatori I , Vizoso DB , Smith AD , Ladurner P , Scharer L , McCombie WR , Hannon GJ , Schatz M
Ref : Proc Natl Acad Sci U S A , 112 :12462 , 2015
Abstract : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
ESTHER : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedSearch : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedID: 26392545
Gene_locus related to this paper: 9plat-a0a267ec96 , 9plat-a0a267e1q9 , 9plat-a0a1i8i888 , 9plat-a0a1i8i7g4 , 9plat-a0a1i8gq29 , 9plat-a0a1i8h217 , 9plat-a0a1i8g0z8.1 , 9plat-a0a1i8ggj9 , 9plat-a0a1i8gre8 , 9plat-a0a1i8hbi6.1 , 9plat-a0a1i8isp7