9plat-a0a1i8i7g4

Macrostomum lignano Uncharacterized protein

Comment

Relationship

Family : Cholinesterase-like

Block : C

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MESTLTTLLLLLALSAAAVSAQRNFTIVRYLNVTTTQGPI
RGAVIETKGS GDNKMVHIGSFLGINFAKVPTGEFRFAHP
VFTKWDFVQDVLDFDRRCYQD PGASGDYQTMSESCIAAN
IWTPYNGTSSNPGSYPVLVWIHGGRFETGSII EEINSGR
VLTAHESIVTVSLQYRLGVLGFLRLSSTVAPGNMGLKDQA
LGL EFVHKNIERFGGNLQTVTLMGLDAGAAAVGYHMLND
NTKTYFKRAVMLGG SPMVFWSVRNDTSLVERLHLDFAVR
QLSCPLPDQGDFNATIQCLREVSPE KLVNEQLNYNRLFQ
GVEFPPVIDGDYIKEDPIEAFRNGRFEGMSLMIGVT NAE
AAVYVERSLESQKLTQDQLADRATYERVLRDQFRYYERQP
DLLSVTG QNVMYDRLTDFGNPSGPAQYKRWLDGASDRLF
VSAANEFAEKMSEKNQGT SNDVYFYVFSEQDNTPNYIGA
SHGSDAYYFFGNPTDDAPIVKPEQADLSV RMMDYLAKFV
ETGDPVPRDEEEVWAKYNSSHRFYHNFTIDLETFASSYNV
PYGFRRDDCGFWDQTLNYVNTLVESSPTTTAMTSTTTST
TTTATTTTTDT TTATPEPSTRPPIGPVPSCNFVFNTAAA
ITLGVLLPTNLLTGAALGFLFF KYNKAVKGVTPV

References

Title : Genome and transcriptome of the regeneration-competent flatworm, Macrostomum lignano - Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
Author(s) : Wasik K , Gurtowski J , Zhou X , Ramos OM , Delas MJ , Battistoni G , El Demerdash O , Falciatori I , Vizoso DB , Smith AD , Ladurner P , Scharer L , McCombie WR , Hannon GJ , Schatz M
Ref : Proc Natl Acad Sci U S A , 112 :12462 , 2015
Abstract : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
ESTHER : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedSearch : Wasik_2015_Proc.Natl.Acad.Sci.U.S.A_112_12462
PubMedID: 26392545
Gene_locus related to this paper: 9plat-a0a267ec96 , 9plat-a0a267e1q9 , 9plat-a0a1i8i888 , 9plat-a0a1i8i7g4 , 9plat-a0a1i8gq29 , 9plat-a0a1i8h217 , 9plat-a0a1i8g0z8.1 , 9plat-a0a1i8ggj9 , 9plat-a0a1i8gre8 , 9plat-a0a1i8hbi6.1 , 9plat-a0a1i8isp7