artan-a0a2u1n4s5

Artemisia annua (Sweet wormwood). Lipase_3 domain-containing protein

Comment

Relationship

Family : Triacylglycerol-lipase-OBL1-like

Block : L

Position in NCBI Life Tree : Artemisia annua

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MDMYCDKSFSTGKYMLLDHEKVGVVDLVQMLHSIDIKKRN
FVDCPNDMIE ESFKRRWLLSMSVLAQKILKSIAKPLADT
GSAIEYWLNLVSCNGNLGGLI WNLIRGEMIQPDKTSATF
VSFTGNLDTRVELDKTITKCGDKDRYISLLSV MAAKASY
ENHAYLQYTVTDIWKMELLGSYDFWNDYQQKATTQAFMLR
DKI DDYDLIVVAFRGTETFDADAWSSDVDLSWYELKDMG
KVHGGFMKALGLKK SQGFEKDLIMNPGEPLAYYVIRDML
KQALKENNKTKFIVTGHSLGGALAV LFTAVLMKDNEVEL
LGMLEGVYTYGQPRVGDETFGHFMEKNMEIHQVKYY RTV
YSNDLVPRLPYDDSTMMFKHFGTCLYFDSFYNGKIVDEEP
NKNYFSL LSAIPKLINAGWEIIRSFVIPYTRGADYSEGF
LLKMYRLVGLMIAGVPAH GLQDYVNSVRIRSELYKDHSI
LSNITTTLVIEDGTFK

References

Title : The Genome of Artemisia annua Provides Insight into the Evolution of Asteraceae Family and Artemisinin Biosynthesis - Shen_2018_Mol.Plant_11_776
Author(s) : Shen Q , Zhang L , Liao Z , Wang S , Yan T , Shi P , Liu M , Fu X , Pan Q , Wang Y , Lv Z , Lu X , Zhang F , Jiang W , Ma Y , Chen M , Hao X , Li L , Tang Y , Lv G , Zhou Y , Sun X , Brodelius PE , Rose JKC , Tang K
Ref : Mol Plant , 11 :776 , 2018
Abstract : Shen_2018_Mol.Plant_11_776
ESTHER : Shen_2018_Mol.Plant_11_776
PubMedSearch : Shen_2018_Mol.Plant_11_776
PubMedID: 29703587
Gene_locus related to this paper: artan-a0a2u1ns65 , artan-a0a2u1nuf0 , artan-a0a2u1pw87 , artan-a0a2u1ql98 , artan-a0a2u1n9p7.2 , artan-a0a2u1ky94 , artan-a0a2u1pvq0 , artan-a0a2u1q8x4 , artan-a0a2u1mtd1 , artan-a0a2u1l9j8 , artan-a0a2u1lak5 , artan-a0a2u1lfl1 , artan-a0a2u1lzs1 , artan-a0a2u1m5v6 , artan-a0a2u1n4s5 , artan-a0a2u1qgg7