artan-a0a2u1q8x4

Artemisia annua (Sweet wormwood). Alpha/beta hydrolase fold-3

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Artemisia annua

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSTNEIVTEIPGVFRIFEDGTFHRLHATNIVSAGTDPTTA
VESKDIIFSP ENNISARIYIPPNKTSDHKSNRLPLLIFY
HGGGFCIESAKSSLYHNFLNL VVSESNVVVVSVDYRLAP
EFPLPVAYEDSWDAIKWIAKHVNGNGPESWLN EYADFKN
VFLAGDSAGGNIAHHMAIRVGSSCPDGLEFKGAILLHPYF
WGK ERIGNESTWIESMVKNLDTLWAIVSPGSSGSDDPLI
NPEMDPRIAGIGCP RMLVCIGGNCFMRDRDWNYTKIVEK
SGWNGDLEVVEDKGEEHVFFLANPD SANASLLRTRICTF
ISKT

References

Title : The Genome of Artemisia annua Provides Insight into the Evolution of Asteraceae Family and Artemisinin Biosynthesis - Shen_2018_Mol.Plant_11_776
Author(s) : Shen Q , Zhang L , Liao Z , Wang S , Yan T , Shi P , Liu M , Fu X , Pan Q , Wang Y , Lv Z , Lu X , Zhang F , Jiang W , Ma Y , Chen M , Hao X , Li L , Tang Y , Lv G , Zhou Y , Sun X , Brodelius PE , Rose JKC , Tang K
Ref : Mol Plant , 11 :776 , 2018
Abstract : Shen_2018_Mol.Plant_11_776
ESTHER : Shen_2018_Mol.Plant_11_776
PubMedSearch : Shen_2018_Mol.Plant_11_776
PubMedID: 29703587
Gene_locus related to this paper: artan-a0a2u1ns65 , artan-a0a2u1nuf0 , artan-a0a2u1pw87 , artan-a0a2u1ql98 , artan-a0a2u1n9p7.2 , artan-a0a2u1ky94 , artan-a0a2u1pvq0 , artan-a0a2u1q8x4 , artan-a0a2u1mtd1 , artan-a0a2u1l9j8 , artan-a0a2u1lak5 , artan-a0a2u1lfl1 , artan-a0a2u1lzs1 , artan-a0a2u1m5v6 , artan-a0a2u1n4s5 , artan-a0a2u1qgg7