capan-a0a1u8flz5

Capsicum annuum (Capsicum pepper); Capsicum baccatum (Peruvian pepper). Abhydrolase_3 domain-containing protein

Comment

"Other strains: Capsicum annuum (Capsicum pepper)\; Capsicum baccatum (Peruvian pepper)\; Capsicum chinense (Scotch bonnet) (Bonnet pepper)"

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Capsicum annuum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MSIIAEAPGYIQVFSDGTVKRFEPEISTASIEPCNGYKSK
DVVIDPLKPI FGRMYLPESSVLHQQFPVLVYFHGGGFCI
GSTTWLGYHIFLGDLSVASKC IVLSVDYRLAPENRLPTA
YEDCYSALEWLINNLEIEPWLKRAYLSQVFLS GDSAGGN
IVHQVAIRAIRSEVFCGRLKGLLPIHPYFGSEKRTELEMA
NGS AGDVEMNDMFWRLSLPRGSNRDYFGCNFENAELSMA
EWSLFPAVIVFVAG LDFLKERGVMYAEFLKKKGVKTVKV
VEAEEQVHVHHVFHPESEATRLLQS QMSDFINSF

References

Title : New reference genome sequences of hot pepper reveal the massive evolution of plant disease-resistance genes by retroduplication - Kim_2017_Genome.Biol_18_210
Author(s) : Kim S , Park J , Yeom SI , Kim YM , Seo E , Kim KT , Kim MS , Lee JM , Cheong K , Shin HS , Kim SB , Han K , Lee J , Park M , Lee HA , Lee HY , Lee Y , Oh S , Lee JH , Choi E , Lee SE , Jeon J , Kim H , Choi G , Song H , Lee SC , Kwon JK , Koo N , Hong Y , Kim RW , Kang WH , Huh JH , Kang BC , Yang TJ , Lee YH , Bennetzen JL , Choi D
Ref : Genome Biol , 18 :210 , 2017
Abstract : Kim_2017_Genome.Biol_18_210
ESTHER : Kim_2017_Genome.Biol_18_210
PubMedSearch : Kim_2017_Genome.Biol_18_210
PubMedID: 29089032
Gene_locus related to this paper: capch-q75qh4 , capan-a0a1u8fuf5 , capan-a0a1u8gmz3 , capch-a0a2g3bqp0 , capba-a0a2g2vcw4 , capan-a0a1u8flz5 , capch-a0a2g3bau3 , capch-a0a2g3b6c0 , capan-a0a2g2y016 , capch-a0a2g3cje8 , capba-a0a2g2xr67 , capan-a0a1u8fpc9 , capan-a0a1u8fqs3 , capan-a0a1u8ft99 , capan-a0a2g2xtt0 , capan-a0a1u8eu02 , capan-a0a1u8hd13 , capan-a0a2g2y0b6