capan-a0a2g2y0b6

Capsicum annuum (Capsicum pepper). Protein AUXIN RESPONSE 4

Comment

Relationship

Family : Auxin-response-4

Block : X

Position in NCBI Life Tree : Capsicum annuum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAIITEEPDSPTPKKQQKPLKPTSRTPQSTTPKPTKSTKT
TNTTNPFHFW FYFTISVSLITLIFMILTSLYPQDPKTWF
LSLPPNLRQHYSKGRNIKVQT TPNQPQIEVFAIQEGPSK
ASDQVLIVHGLGCSSFAFQKVVSFLGVRGVHA VAIDLPG
SGFSDKTIVVEEEHVDDGVLGRLKDMYSEIQEKGIFWGFD
QLV EQGYVNYEENKIRVSKRNVVKTVDLGPEEIGKVLGQ
VIDTMGLSPVDLVL HDSALGLSANWISENRGLLRSVVVL
DSAPSGTALPVWVLEMPLLGDVVLG LGFAFRRLLGTCCL
RWVGNAEAECHRILLKGKDGRGAVVGMRRSLNSSFD LNE
WLALDGVKGLPMQVIWSDALSKEWTEEGRQVADAIPQAKF
VGHSGGR WPQEHNSEEIAESICQFVSSLPNSVKQTEEEP
VPEHVQKMSDEAQSGDRR HHHHHHHGHDSHGHGHEHAHA
GYMDAYGLGQGWAM

References

Title : New reference genome sequences of hot pepper reveal the massive evolution of plant disease-resistance genes by retroduplication - Kim_2017_Genome.Biol_18_210
Author(s) : Kim S , Park J , Yeom SI , Kim YM , Seo E , Kim KT , Kim MS , Lee JM , Cheong K , Shin HS , Kim SB , Han K , Lee J , Park M , Lee HA , Lee HY , Lee Y , Oh S , Lee JH , Choi E , Lee SE , Jeon J , Kim H , Choi G , Song H , Lee SC , Kwon JK , Koo N , Hong Y , Kim RW , Kang WH , Huh JH , Kang BC , Yang TJ , Lee YH , Bennetzen JL , Choi D
Ref : Genome Biol , 18 :210 , 2017
Abstract : Kim_2017_Genome.Biol_18_210
ESTHER : Kim_2017_Genome.Biol_18_210
PubMedSearch : Kim_2017_Genome.Biol_18_210
PubMedID: 29089032
Gene_locus related to this paper: capch-q75qh4 , capan-a0a1u8fuf5 , capan-a0a1u8gmz3 , capch-a0a2g3bqp0 , capba-a0a2g2vcw4 , capan-a0a1u8flz5 , capch-a0a2g3bau3 , capch-a0a2g3b6c0 , capan-a0a2g2y016 , capch-a0a2g3cje8 , capba-a0a2g2xr67 , capan-a0a1u8fpc9 , capan-a0a1u8fqs3 , capan-a0a1u8ft99 , capan-a0a2g2xtt0 , capan-a0a1u8eu02 , capan-a0a1u8hd13 , capan-a0a2g2y0b6