capan-a0a1u8fpc9

Capsicum annuum (Capsicum pepper). Lipase_3 domain-containing protein

Comment

Relationship

Family : Triacylglycerol-lipase-OBL1-like

Block : L

Position in NCBI Life Tree : Capsicum annuum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MASSSACNKSFCDNYMLLKPEECSVLDLARILFSGKNIGQ
KDFVDCPNDE MTTTKEHLSRRWVIFISLLVQKVLIATAK
PLAGFGNAIEYWLNLLNVNGG FFRLIFNSVRGKTVIPDK
ESANFLSFIGNLDKRVELVDNSRCVEELGGRR GYDEAIS
IMAAKAAYENKACIETTVKDNWKMDLIGCFDFWNDDQQKA
TTQ AFVLQDKNVDPELIVVAFRGTEFFNSDDWISDFNLS
WYEISGMGKVHAGF MKALGLQKSNGWPKDIEQTDNNQLS
PAYYFLRKLLKQLLEKNEKARFLVT GHSLGGALAILFPA
ILAYHEESWLLKRLEGVYTFGQPRVGDETFVEYMKG QLS
KHEVPYYRVVYSNDMVPRLPYDNATFGFKHFGTCIYYNSL
YKEKILG EEPDKNGLALLLFLPKMLNAAWELIRSFILPC
VNGRKYTEGGLLLFMRVV GLILPGIPAHCPQDYVNATRL
GSSDQSYAIENAAKYQKIGLVPA

References

Title : New reference genome sequences of hot pepper reveal the massive evolution of plant disease-resistance genes by retroduplication - Kim_2017_Genome.Biol_18_210
Author(s) : Kim S , Park J , Yeom SI , Kim YM , Seo E , Kim KT , Kim MS , Lee JM , Cheong K , Shin HS , Kim SB , Han K , Lee J , Park M , Lee HA , Lee HY , Lee Y , Oh S , Lee JH , Choi E , Lee SE , Jeon J , Kim H , Choi G , Song H , Lee SC , Kwon JK , Koo N , Hong Y , Kim RW , Kang WH , Huh JH , Kang BC , Yang TJ , Lee YH , Bennetzen JL , Choi D
Ref : Genome Biol , 18 :210 , 2017
Abstract : Kim_2017_Genome.Biol_18_210
ESTHER : Kim_2017_Genome.Biol_18_210
PubMedSearch : Kim_2017_Genome.Biol_18_210
PubMedID: 29089032
Gene_locus related to this paper: capch-q75qh4 , capan-a0a1u8fuf5 , capan-a0a1u8gmz3 , capch-a0a2g3bqp0 , capba-a0a2g2vcw4 , capan-a0a1u8flz5 , capch-a0a2g3bau3 , capch-a0a2g3b6c0 , capan-a0a2g2y016 , capch-a0a2g3cje8 , capba-a0a2g2xr67 , capan-a0a1u8fpc9 , capan-a0a1u8fqs3 , capan-a0a1u8ft99 , capan-a0a2g2xtt0 , capan-a0a1u8eu02 , capan-a0a1u8hd13 , capan-a0a2g2y0b6