capan-a0a1u8hd13

Capsicum annuum (Capsicum pepper); Capsicum baccatum (Peruvian pepper). Uncharacterized protein

Comment

"Other strains: Capsicum annuum (Capsicum pepper)\; Capsicum baccatum (Peruvian pepper)"

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Capsicum annuum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVIIGEGIEVKDELIKKACNLAMEAHTLSSGKPYIYKKKS
GSMDAVFGFA GTWSLDGWYNNTSFGETKINVSLFPSMRS
VGTDELAMVNEAFARRFEDIL NKSSLKNEVEKAMSDGKQ
IVFTGHSFGGPIAILAALWCLEYRRTRSNDNL VYPYCMT
FGSPLVGDRIWSHALRRENWAHYFIHFVMKYDVVPRMMLA
PLS SIQELVQAIFAGINPKSPNVSGARSSDALNFFMTVM
RSASCVASYAACNL KGCTNLLLETVSNIVQLSLYRPFGT
YIFCTGNGKLVVIENPDAVLQLLFY SSQLSSEAEAEVID
ARSLNEHLLYRNEMQESLEMQDAVCLNNLTDIPLSS NVN
PSDEVATMNSALNDLGLSTRARLCLRAAGEWEKQKKKNEE
KIDLNKK SIVDGLSKIQEYQTKCDIQKVGYYDAFKLQVN
IDDFNANVKRLELAGIWD EIIEMLKRYELPDSFEGRKEW
IQLGTQFRRKVEPLDIANYYRHLKNEDTG PYMIRARPKR
YRFTQRWLEHFERVQSGARSESCFWAEVEELRNKTFEEVQ
NRVLSLETNAWGWFQRGLLGNDVFFPESTFTKWWKTLPT
QRTQASWVSSH INS

References

Title : New reference genome sequences of hot pepper reveal the massive evolution of plant disease-resistance genes by retroduplication - Kim_2017_Genome.Biol_18_210
Author(s) : Kim S , Park J , Yeom SI , Kim YM , Seo E , Kim KT , Kim MS , Lee JM , Cheong K , Shin HS , Kim SB , Han K , Lee J , Park M , Lee HA , Lee HY , Lee Y , Oh S , Lee JH , Choi E , Lee SE , Jeon J , Kim H , Choi G , Song H , Lee SC , Kwon JK , Koo N , Hong Y , Kim RW , Kang WH , Huh JH , Kang BC , Yang TJ , Lee YH , Bennetzen JL , Choi D
Ref : Genome Biol , 18 :210 , 2017
Abstract : Kim_2017_Genome.Biol_18_210
ESTHER : Kim_2017_Genome.Biol_18_210
PubMedSearch : Kim_2017_Genome.Biol_18_210
PubMedID: 29089032
Gene_locus related to this paper: capch-q75qh4 , capan-a0a1u8fuf5 , capan-a0a1u8gmz3 , capch-a0a2g3bqp0 , capba-a0a2g2vcw4 , capan-a0a1u8flz5 , capch-a0a2g3bau3 , capch-a0a2g3b6c0 , capan-a0a2g2y016 , capch-a0a2g3cje8 , capba-a0a2g2xr67 , capan-a0a1u8fpc9 , capan-a0a1u8fqs3 , capan-a0a1u8ft99 , capan-a0a2g2xtt0 , capan-a0a1u8eu02 , capan-a0a1u8hd13 , capan-a0a2g2y0b6