capan-a0a1u8gmz3

Capsicum annuum (Bell pepper); Capsicum baccatum (Peruvian pepper); Capsicum chinense (Scotch bonnet) (Bonnet pepper). uncharacterized protein LOC107870576 isoform X1

Comment

"Other strains: Capsicum annuum (Bell pepper)\; Capsicum baccatum (Peruvian pepper)\; Capsicum chinense (Scotch bonnet) (Bonnet pepper)"

Relationship

Family : UCP031088

Block : X

Position in NCBI Life Tree : Capsicum annuum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MSHPIQSDIRSAIQIAAVFRRNNQYHHLKCHRWLLPAAVI
SYRTSPNCCF TVNSALKLRAFSTNDGGDTTFHKVSNKQS
LCTADELHYVSVNNSDWKLSL WRYIPPPQAPKRNHPLLL
LSGVGTNAIGYDLAPGSSFARYMSGEGFDTWV LELRGAG
LSVQESDSTNIEKFTNAVSEQMEAATDNATDKVLSAARQS
TDV QSTLEESDIAVVKEEPAAITTMWDESRVVNQLTETF
MRLSERVSGFLNES QSRIMSAKLFDQISKLLEDSFLYER
FNETRGKLLSLLESGQNSAVADQVK DLSQKLVNIIEEGQ
RSVSPLVDLHERLTTTIEDFQKQLDLIVKYDWDFDH YLE
DDVPAAMEYVKAQTAPKDGKLLAIGHSMGGILLYARLSQC
GLEGRES GLAAIVTLASSLDYTSSKSVLKLLLPLADPAQ
ALNVPVVPLGALLAAAYP LSSRPPYVLSWLNDLISAADT
MHPELLKKLVLNNFCTIPAKLILQLITAF REGGLCDRSG
KVFYKDNLHKCDIPVLAVAGDKDIICPPEAVYETAKLIPE
HLVTYKVFGDASGQHYAHYDLVGGRMAAEYVYPCIIQFL
SRCDDTS

References

Title : New reference genome sequences of hot pepper reveal the massive evolution of plant disease-resistance genes by retroduplication - Kim_2017_Genome.Biol_18_210
Author(s) : Kim S , Park J , Yeom SI , Kim YM , Seo E , Kim KT , Kim MS , Lee JM , Cheong K , Shin HS , Kim SB , Han K , Lee J , Park M , Lee HA , Lee HY , Lee Y , Oh S , Lee JH , Choi E , Lee SE , Jeon J , Kim H , Choi G , Song H , Lee SC , Kwon JK , Koo N , Hong Y , Kim RW , Kang WH , Huh JH , Kang BC , Yang TJ , Lee YH , Bennetzen JL , Choi D
Ref : Genome Biol , 18 :210 , 2017
Abstract : Kim_2017_Genome.Biol_18_210
ESTHER : Kim_2017_Genome.Biol_18_210
PubMedSearch : Kim_2017_Genome.Biol_18_210
PubMedID: 29089032
Gene_locus related to this paper: capch-q75qh4 , capan-a0a1u8fuf5 , capan-a0a1u8gmz3 , capch-a0a2g3bqp0 , capba-a0a2g2vcw4 , capan-a0a1u8flz5 , capch-a0a2g3bau3 , capch-a0a2g3b6c0 , capan-a0a2g2y016 , capch-a0a2g3cje8 , capba-a0a2g2xr67 , capan-a0a1u8fpc9 , capan-a0a1u8fqs3 , capan-a0a1u8ft99 , capan-a0a2g2xtt0 , capan-a0a1u8eu02 , capan-a0a1u8hd13 , capan-a0a2g2y0b6

Title : Whole-genome sequencing of cultivated and wild peppers provides insights into Capsicum domestication and specialization - Qin_2014_Proc.Natl.Acad.Sci.U.S.A_111_5135
Author(s) : Qin C , Yu C , Shen Y , Fang X , Chen L , Min J , Cheng J , Zhao S , Xu M , Luo Y , Yang Y , Wu Z , Mao L , Wu H , Ling-Hu C , Zhou H , Lin H , Gonzalez-Morales S , Trejo-Saavedra DL , Tian H , Tang X , Zhao M , Huang Z , Zhou A , Yao X , Cui J , Li W , Chen Z , Feng Y , Niu Y , Bi S , Yang X , Cai H , Luo X , Montes-Hernandez S , Leyva-Gonzalez MA , Xiong Z , He X , Bai L , Tan S , Liu D , Liu J , Zhang S , Chen M , Zhang L , Zhang Y , Liao W , Wang M , Lv X , Wen B , Liu H , Luan H , Yang S , Wang X , Xu J , Li X , Li S , Wang J , Palloix A , Bosland PW , Li Y , Krogh A , Rivera-Bustamante RF , Herrera-Estrella L , Yin Y , Yu J , Hu K , Zhang Z
Ref : Proc Natl Acad Sci U S A , 111 :5135 , 2014
Abstract : Qin_2014_Proc.Natl.Acad.Sci.U.S.A_111_5135
ESTHER : Qin_2014_Proc.Natl.Acad.Sci.U.S.A_111_5135
PubMedSearch : Qin_2014_Proc.Natl.Acad.Sci.U.S.A_111_5135
PubMedID: 24591624
Gene_locus related to this paper: capch-q75qh4 , capan-a0a1u8fuf5 , capan-a0a1u8gmz3 , capan-a0a1u8f879 , capan-a0a1u8ftr2 , capan-a0a1u8g8s6