legpa-q5x3j6

Legionella pneumophila (strain Paris) hypothetical protein

Comment

Relationship

Family : PhaC_cen_dom

Block : X

Position in NCBI Life Tree : Legionella pneumophila

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MSAMKGLEKQCCSKERILTQSQELQEGGDFSCCVPVESTS
SNSFFSFFTR LTQANLAKWTAGISPAAIGSSYSTWLWQL
AQSPGVLWELAFYPVLHAKDC INNIVCAERAADGKDVRF
KKNSWQPMPWRLFAEGFLQMEDWWRRATTDVP GLPKPVE
RTVSFWARQCLDALSPSNFAWSNPDLFHEAMRTGGLNLIQ
GTQ IALEDWLEKLAGAPPTGSEHFIPGQHVAITPGRVVF
QNHLIELIQYESHT KTVYKEPILIFPAWIMKYYILDLSP
HNSMVKWLVSQGHTVFIISWRNPDK EDRDLGMDDYYRQG
AMAAIDTVSTLLPGTKINLMGYCLGGTLAMITASAM GRD
KDERLNSLTLLAAQGDFTEAGELMLFVTESQVDFLKSMMR
EQGYLDT KQMAGSFQMLRAYDLIWSKMVQDYMHGMRRGM
IDLTAWNADATRMPYKMH SEYLEKLFLRNDFAEGRYTVE
GKPVAAENIERPVFAVSTEKDHVAPWQSV YKIHLMVKGD
VTFVLTDGGHNAGIISEPGHLGRSYHVHEHTQGETYLNPE
SWLAMANVREGSWWQEWHEWLVRQNSKKLIPPPGLYPN

References