musdo-ACHE

Musca domestica (House fly) protein for acetylcholinesterase (partial)

Comment

Kosaki et al. 2002 polymorphisme of musdo-ACHE : AAM69372 strain YPRN, AAM69371 strain YBOL, AAM69370 strain LPR, AAM69369 strain CT, AAM69368 strain MSK, AAM69367 strain SRS || The sequence is slightly different from the one previously published, the peptide seq is now the one of CAC39209.1 entered by Williamson. We put the mature peptide so that mutation numbering is the same as published. The signal peptide is MARSVRTPISPSSSSSSSRSSWSSPSSSFYSLLSSFKASLTRPSSSSSVAHHLAARNNDICRGLFATLVILLRMSALTSA and may vary among strain see Kozaki et al 2001 AF281161 . More recently (Aug2002) a new sequence appeared by Kim et Kim genbank AF533335 nid 22347827 pid 22347828 strain aabys Fenitroxon insensitive AChE || Musca domestica strain YPRN acetylcholinesterase AF281167 strain YBOL AF281166 strain LPR AF281165 strain CT AF281164 strain MSK AF281163 strain SRS AF281162 by Kozaki,T., Shono,T., Tomita,T. and Kono,Y. q2yhq7 is from an insecticide resistant strain Tang Z.H., Shang J.Y., Shi M.A., Zhang C.X || The sequence of Kim et al. 2003 Q7YWJ9 AY134873 differs in five aa I82M\/G262A\/F327Y and E199S and A201S??? || C terminus H peptide

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Musca domestica

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)

> cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Protostomia N E > Ecdysozoa N E > Panarthropoda N E > Arthropoda N E > Mandibulata N E > Pancrustacea N E > Hexapoda N E > Insecta N E > Dicondylia N E > Pterygota N E > Neoptera N E > Holometabola N E > Diptera N E > Brachycera N E > Muscomorpha N E > Eremoneura N E > Cyclorrhapha N E > Schizophora N E > Calyptratae N E > Muscoidea N E > Muscidae N E > Muscinae N E > Muscini N E > Musca [genus] N E > Musca [subgenus] N E > Musca domestica N E

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MTDHLTVQTT SGPVRGRSVT VQGRDVHVFT GIPYAKPPVD DLRFRKPVPA EPWHGVLDAT RLPATCVQER YEYFPGFSGE EIWNPNTNVS EDCLFMNIWA PAKARLRHGR GTNGGEHSSK TDQDHLIHSA TPQNTTNGLP ILIWIYGGGF MTGSATLDIY NAEIMSAVGN VIVASFQYRV GAFGFLHLSP VMPGFEEEAP GNVGLWDQAL ALRWLKENAR AFGGNPEWMT LFGESAGSSS VNAQLMSPVT RGLVKRGMMQ SGTMNAPWSH MTSEKAVEIG KALVNDCNCN ASLLPENPQA VMACMRQVDA KTISVQQWNS YSGILSFPSA PTIDGAFLPA DPMTLLKTAD LSGYDILIGN VKDEGTYFLL YDFIDYFDKD DATSLPRDKY LEIMNNIFQK ASQAEREAII FQYTSWEGNP GYQNQQQIGR AVGDHFFTCP TNEYAQALAE RGASVHYYYF THRTSTSLWG EWMGVLHGDE IEYFFGQPLN NSLQYRPVER ELGKRMLNSV IEFAKSGNPA VDGEEWPNFS KEDPVYYVFS TDEKIEKLQR GPLAKRCSFW NDYLPKVRSW IGSECENKSS TSASAAIYEM KMQQLTLLAV AIILTMVNSI FQ

References (9)

Title : Frequencies and distribution of kdr and Ace alleles that cause insecticide resistance in house flies in the United States - Mertz_2023_Pestic.Biochem.Physiol_194_105497
Author(s) : Mertz RW , Dressel AE , Fisher CR , Moon RD , Donahue WA , Kasai S , Scott JG
Ref : Pestic Biochem Physiol , 194 :105497 , 2023
PubMedID: 37532356
Gene_locus related to this paper: musdo-ACHE

Title : Molecular analysis of acetylcholinesterase gene in field-collected populations of Musca domestica (Diptera: Muscidae) in Northwestern Iran - Adib_2023_J.Insect.Sci_23_9
Author(s) : Adib D , Jafari A , Silivanova E , Basseri H , Gholizadeh S
Ref : J Insect Sci , 23 :9 , 2023
PubMedID: 37480682
Gene_locus related to this paper: musdo-ACHE

Title : Frequencies and evolution of organophosphate insensitive acetylcholinesterase alleles in laboratory and field populations of the house fly, Musca domestica L. - Kozaki_2009_Pestic.Biochem.Physiol_95_6
Author(s) : Kozaki T , Brady SG , Scott JG
Ref : Pesticide Biochemistry and Physiology , 95 :6 , 2009
PubMedID:
Gene_locus related to this paper: musdo-ACHE

Title : Cloning, mutagenesis, and expression of the acetylcholinesterase gene from a strain of Musca domestica\; the change from a drug-resistant to a sensitive enzyme - Kim_2003_Mol.Cells_15_208
Author(s) : Kim CS , Kim WT , Boo KS , Kim SI
Ref : Mol Cells , 15 :208 , 2003
PubMedID: 12803484
Gene_locus related to this paper: musdo-ACHE

Title : Linkage analysis of an acetylcholinesterase gene in the house fly Musca domestica (Diptera: Muscidae) - Kozaki_2002_J.Econ.Entomol_95_129
Author(s) : Kozaki O , Shono T , Tomita T , Taylor D , Kono Y
Ref : J Econ Entomol , 95 :129 , 2002
PubMedID: 11942747
Gene_locus related to this paper: musdo-ACHE

Title : Fenitroxon insensitive acetylcholinesterases of the housefly, Musca domestica associated with point mutations - Kozaki_2001_Insect.Biochem.Mol.Biol_31_991
Author(s) : Kozaki T , Shono T , Tomita T , Kono Y
Ref : Insect Biochemistry & Molecular Biology , 31 :991 , 2001
PubMedID: 11483435
Gene_locus related to this paper: musdo-ACHE

Title : Identification and characterization of mutations in housefly (Musca domestica) acetylcholinesterase involved in insecticide resistance - Walsh_2001_Biochem.J_359_175
Author(s) : Walsh SB , Dolden TA , Moores GD , Kristensen M , Lewis T , Devonshire AL , Williamson MS
Ref : Biochemical Journal , 359 :175 , 2001
PubMedID: 11563981
Gene_locus related to this paper: musdo-ACHE

Title : Characterization of the acetylcholinesterase gene from insecticide-resistant houseflies (Musca domestica) - Huang_1997_Chin.J.Biotechnol_13_177
Author(s) : Huang Y , Qiao C , Williamson MS , Devonshire AL
Ref : Chin J Biotechnol , 13 :177 , 1997
PubMedID: 9429779
Gene_locus related to this paper: musdo-ACHE

Title : Altered Forms of Acetylcholinesterase in Insecticide-Resistant Houseflies (Musca Domestica) -
Author(s) : Williamson MS , Moores GD
Ref : In Multidisciplinary approaches to cholinesterase functions - Proceedings of Fourth International Meeting on Cholinesterases , (Shafferman, A. and Velan, B., Eds) Plenum Press, New York :83 , 1992
PubMedID:
Gene_locus related to this paper: musdo-ACHE