Musca domestica (House fly) protein for acetylcholinesterase (partial)
Kosaki et al. 2002 polymorphisme of musdo-ACHE : AAM69372 strain YPRN, AAM69371 strain YBOL, AAM69370 strain LPR, AAM69369 strain CT, AAM69368 strain MSK, AAM69367 strain SRS || The sequence is slightly different from the one previously published, the peptide seq is now the one of CAC39209.1 entered by Williamson. We put the mature peptide so that mutation numbering is the same as published. The signal peptide is MARSVRTPISPSSSSSSSRSSWSSPSSSFYSLLSSFKASLTRPSSSSSVAHHLAARNNDICRGLFATLVILLRMSALTSA and may vary among strain see Kozaki et al 2001 AF281161 . More recently (Aug2002) a new sequence appeared by Kim et Kim genbank AF533335 nid 22347827 pid 22347828 strain aabys Fenitroxon insensitive AChE || Musca domestica strain YPRN acetylcholinesterase AF281167 strain YBOL AF281166 strain LPR AF281165 strain CT AF281164 strain MSK AF281163 strain SRS AF281162 by Kozaki,T., Shono,T., Tomita,T. and Kono,Y. q2yhq7 is from an insecticide resistant strain Tang Z.H., Shang J.Y., Shi M.A., Zhang C.X || The sequence of Kim et al. 2003 Q7YWJ9 AY134873 differs in five aa I82M\/G262A\/F327Y and E199S and A201S??? || C terminus H peptide
Family : ACHE
Block : C
Position in NCBI Life Tree : Musca domestica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Protostomia N E > Ecdysozoa N E > Panarthropoda N E > Arthropoda N E > Mandibulata N E > Pancrustacea N E > Hexapoda N E > Insecta N E > Dicondylia N E > Pterygota N E > Neoptera N E > Holometabola N E > Diptera N E > Brachycera N E > Muscomorpha N E > Eremoneura N E > Cyclorrhapha N E > Schizophora N E > Calyptratae N E > Muscoidea N E > Muscidae N E > Muscinae N E > Muscini N E > Musca [genus] N E > Musca [subgenus] N E > Musca domestica N E > cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Protostomia N E > Ecdysozoa N E > Panarthropoda N E > Arthropoda N E > Mandibulata N E > Pancrustacea N E > Hexapoda N E > Insecta N E > Dicondylia N E > Pterygota N E > Neoptera N E > Holometabola N E > Diptera N E > Brachycera N E > Muscomorpha N E > Eremoneura N E > Cyclorrhapha N E > Schizophora N E > Calyptratae N E > Muscoidea N E > Muscidae N E > Muscinae N E > Muscini N E > Musca [genus] N E > Musca [subgenus] N E > Musca domestica N E > cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Protostomia N E > Ecdysozoa N E > Panarthropoda N E > Arthropoda N E > Mandibulata N E > Pancrustacea N E > Hexapoda N E > Insecta N E > Dicondylia N E > Pterygota N E > Neoptera N E > Holometabola N E > Diptera N E > Brachycera N E > Muscomorpha N E > Eremoneura N E > Cyclorrhapha N E > Schizophora N E > Calyptratae N E > Muscoidea N E > Muscidae N E > Muscinae N E > Muscini N E > Musca [genus] N E > Musca [subgenus] N E > Musca domestica N EMTDHLTVQTT SGPVRGRSVT VQGRDVHVFT GIPYAKPPVD DLRFRKPVPA EPWHGVLDAT RLPATCVQER YEYFPGFSGE EIWNPNTNVS EDCLFMNIWA PAKARLRHGR GTNGGEHSSK TDQDHLIHSA TPQNTTNGLP ILIWIYGGGF MTGSATLDIY NAEIMSAVGN VIVASFQYRV GAFGFLHLSP VMPGFEEEAP GNVGLWDQAL ALRWLKENAR AFGGNPEWMT LFGESAGSSS VNAQLMSPVT RGLVKRGMMQ SGTMNAPWSH MTSEKAVEIG KALVNDCNCN ASLLPENPQA VMACMRQVDA KTISVQQWNS YSGILSFPSA PTIDGAFLPA DPMTLLKTAD LSGYDILIGN VKDEGTYFLL YDFIDYFDKD DATSLPRDKY LEIMNNIFQK ASQAEREAII FQYTSWEGNP GYQNQQQIGR AVGDHFFTCP TNEYAQALAE RGASVHYYYF THRTSTSLWG EWMGVLHGDE IEYFFGQPLN NSLQYRPVER ELGKRMLNSV IEFAKSGNPA VDGEEWPNFS KEDPVYYVFS TDEKIEKLQR GPLAKRCSFW NDYLPKVRSW IGSECENKSS TSASAAIYEM KMQQLTLLAV AIILTMVNSI FQ
| Title : Diversity and distribution of Mdace mutations involved in propoxur resistance in the house fly (Musca domestica L.) in China - You_2024_Pest.Manag.Sci__ |
| Author(s) : You C , Zhang L , Song J , Zhen C , Ji X , Gao X |
| Ref : Pest Manag Sci , : , 2024 |
| Abstract : |
| PubMedSearch : You_2024_Pest.Manag.Sci__ |
| PubMedID: 39421896 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Diversity and distribution of Mdace mutations involved in propoxur resistance in the house fly (Musca domestica L.) in China - You_2024_Pest.Manag.Sci__ |
| Author(s) : You C , Zhang L , Song J , Zhen C , Ji X , Gao X |
| Ref : Pest Manag Sci , : , 2024 |
| Abstract : |
| PubMedSearch : You_2024_Pest.Manag.Sci__ |
| PubMedID: 39421896 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Diversity and distribution of Mdace mutations involved in propoxur resistance in the house fly (Musca domestica L.) in China - You_2024_Pest.Manag.Sci__ |
| Author(s) : You C , Zhang L , Song J , Zhen C , Ji X , Gao X |
| Ref : Pest Manag Sci , : , 2024 |
| Abstract : |
| PubMedSearch : You_2024_Pest.Manag.Sci__ |
| PubMedID: 39421896 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Molecular analysis of acetylcholinesterase gene in field-collected populations of Musca domestica (Diptera: Muscidae) in Northwestern Iran - Adib_2023_J.Insect.Sci_23_9 |
| Author(s) : Adib D , Jafari A , Silivanova E , Basseri H , Gholizadeh S |
| Ref : J Insect Sci , 23 :9 , 2023 |
| Abstract : |
| PubMedSearch : Adib_2023_J.Insect.Sci_23_9 |
| PubMedID: 37480682 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Frequencies and distribution of kdr and Ace alleles that cause insecticide resistance in house flies in the United States - Mertz_2023_Pestic.Biochem.Physiol_194_105497 |
| Author(s) : Mertz RW , Dressel AE , Fisher CR , Moon RD , Donahue WA , Kasai S , Scott JG |
| Ref : Pestic Biochem Physiol , 194 :105497 , 2023 |
| Abstract : |
| PubMedSearch : Mertz_2023_Pestic.Biochem.Physiol_194_105497 |
| PubMedID: 37532356 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Frequencies and distribution of kdr and Ace alleles that cause insecticide resistance in house flies in the United States - Mertz_2023_Pestic.Biochem.Physiol_194_105497 |
| Author(s) : Mertz RW , Dressel AE , Fisher CR , Moon RD , Donahue WA , Kasai S , Scott JG |
| Ref : Pestic Biochem Physiol , 194 :105497 , 2023 |
| Abstract : |
| PubMedSearch : Mertz_2023_Pestic.Biochem.Physiol_194_105497 |
| PubMedID: 37532356 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Molecular analysis of acetylcholinesterase gene in field-collected populations of Musca domestica (Diptera: Muscidae) in Northwestern Iran - Adib_2023_J.Insect.Sci_23_9 |
| Author(s) : Adib D , Jafari A , Silivanova E , Basseri H , Gholizadeh S |
| Ref : J Insect Sci , 23 :9 , 2023 |
| Abstract : |
| PubMedSearch : Adib_2023_J.Insect.Sci_23_9 |
| PubMedID: 37480682 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Frequencies and distribution of kdr and Ace alleles that cause insecticide resistance in house flies in the United States - Mertz_2023_Pestic.Biochem.Physiol_194_105497 |
| Author(s) : Mertz RW , Dressel AE , Fisher CR , Moon RD , Donahue WA , Kasai S , Scott JG |
| Ref : Pestic Biochem Physiol , 194 :105497 , 2023 |
| Abstract : |
| PubMedSearch : Mertz_2023_Pestic.Biochem.Physiol_194_105497 |
| PubMedID: 37532356 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Molecular analysis of acetylcholinesterase gene in field-collected populations of Musca domestica (Diptera: Muscidae) in Northwestern Iran - Adib_2023_J.Insect.Sci_23_9 |
| Author(s) : Adib D , Jafari A , Silivanova E , Basseri H , Gholizadeh S |
| Ref : J Insect Sci , 23 :9 , 2023 |
| Abstract : |
| PubMedSearch : Adib_2023_J.Insect.Sci_23_9 |
| PubMedID: 37480682 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Frequencies and evolution of organophosphate insensitive acetylcholinesterase alleles in laboratory and field populations of the house fly, Musca domestica L. - Kozaki_2009_Pestic.Biochem.Physiol_95_6 |
| Author(s) : Kozaki T , Brady SG , Scott JG |
| Ref : Pesticide Biochemistry and Physiology , 95 :6 , 2009 |
| Abstract : |
| PubMedSearch : Kozaki_2009_Pestic.Biochem.Physiol_95_6 |
| PubMedID: |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Frequencies and evolution of organophosphate insensitive acetylcholinesterase alleles in laboratory and field populations of the house fly, Musca domestica L. - Kozaki_2009_Pestic.Biochem.Physiol_95_6 |
| Author(s) : Kozaki T , Brady SG , Scott JG |
| Ref : Pesticide Biochemistry and Physiology , 95 :6 , 2009 |
| Abstract : |
| PubMedSearch : Kozaki_2009_Pestic.Biochem.Physiol_95_6 |
| PubMedID: |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Frequencies and evolution of organophosphate insensitive acetylcholinesterase alleles in laboratory and field populations of the house fly, Musca domestica L. - Kozaki_2009_Pestic.Biochem.Physiol_95_6 |
| Author(s) : Kozaki T , Brady SG , Scott JG |
| Ref : Pesticide Biochemistry and Physiology , 95 :6 , 2009 |
| Abstract : |
| PubMedSearch : Kozaki_2009_Pestic.Biochem.Physiol_95_6 |
| PubMedID: |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Cloning, mutagenesis, and expression of the acetylcholinesterase gene from a strain of Musca domestica\; the change from a drug-resistant to a sensitive enzyme - Kim_2003_Mol.Cells_15_208 |
| Author(s) : Kim CS , Kim WT , Boo KS , Kim SI |
| Ref : Mol Cells , 15 :208 , 2003 |
| Abstract : |
| PubMedSearch : Kim_2003_Mol.Cells_15_208 |
| PubMedID: 12803484 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Cloning, mutagenesis, and expression of the acetylcholinesterase gene from a strain of Musca domestica\; the change from a drug-resistant to a sensitive enzyme - Kim_2003_Mol.Cells_15_208 |
| Author(s) : Kim CS , Kim WT , Boo KS , Kim SI |
| Ref : Mol Cells , 15 :208 , 2003 |
| Abstract : |
| PubMedSearch : Kim_2003_Mol.Cells_15_208 |
| PubMedID: 12803484 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Cloning, mutagenesis, and expression of the acetylcholinesterase gene from a strain of Musca domestica\; the change from a drug-resistant to a sensitive enzyme - Kim_2003_Mol.Cells_15_208 |
| Author(s) : Kim CS , Kim WT , Boo KS , Kim SI |
| Ref : Mol Cells , 15 :208 , 2003 |
| Abstract : |
| PubMedSearch : Kim_2003_Mol.Cells_15_208 |
| PubMedID: 12803484 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Linkage analysis of an acetylcholinesterase gene in the house fly Musca domestica (Diptera: Muscidae) - Kozaki_2002_J.Econ.Entomol_95_129 |
| Author(s) : Kozaki O , Shono T , Tomita T , Taylor D , Kono Y |
| Ref : J Econ Entomol , 95 :129 , 2002 |
| Abstract : |
| PubMedSearch : Kozaki_2002_J.Econ.Entomol_95_129 |
| PubMedID: 11942747 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Linkage analysis of an acetylcholinesterase gene in the house fly Musca domestica (Diptera: Muscidae) - Kozaki_2002_J.Econ.Entomol_95_129 |
| Author(s) : Kozaki O , Shono T , Tomita T , Taylor D , Kono Y |
| Ref : J Econ Entomol , 95 :129 , 2002 |
| Abstract : |
| PubMedSearch : Kozaki_2002_J.Econ.Entomol_95_129 |
| PubMedID: 11942747 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Linkage analysis of an acetylcholinesterase gene in the house fly Musca domestica (Diptera: Muscidae) - Kozaki_2002_J.Econ.Entomol_95_129 |
| Author(s) : Kozaki O , Shono T , Tomita T , Taylor D , Kono Y |
| Ref : J Econ Entomol , 95 :129 , 2002 |
| Abstract : |
| PubMedSearch : Kozaki_2002_J.Econ.Entomol_95_129 |
| PubMedID: 11942747 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Fenitroxon insensitive acetylcholinesterases of the housefly, Musca domestica associated with point mutations - Kozaki_2001_Insect.Biochem.Mol.Biol_31_991 |
| Author(s) : Kozaki T , Shono T , Tomita T , Kono Y |
| Ref : Insect Biochemistry & Molecular Biology , 31 :991 , 2001 |
| Abstract : |
| PubMedSearch : Kozaki_2001_Insect.Biochem.Mol.Biol_31_991 |
| PubMedID: 11483435 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Identification and characterization of mutations in housefly (Musca domestica) acetylcholinesterase involved in insecticide resistance - Walsh_2001_Biochem.J_359_175 |
| Author(s) : Walsh SB , Dolden TA , Moores GD , Kristensen M , Lewis T , Devonshire AL , Williamson MS |
| Ref : Biochemical Journal , 359 :175 , 2001 |
| Abstract : |
| PubMedSearch : Walsh_2001_Biochem.J_359_175 |
| PubMedID: 11563981 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Fenitroxon insensitive acetylcholinesterases of the housefly, Musca domestica associated with point mutations - Kozaki_2001_Insect.Biochem.Mol.Biol_31_991 |
| Author(s) : Kozaki T , Shono T , Tomita T , Kono Y |
| Ref : Insect Biochemistry & Molecular Biology , 31 :991 , 2001 |
| Abstract : |
| PubMedSearch : Kozaki_2001_Insect.Biochem.Mol.Biol_31_991 |
| PubMedID: 11483435 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Identification and characterization of mutations in housefly (Musca domestica) acetylcholinesterase involved in insecticide resistance - Walsh_2001_Biochem.J_359_175 |
| Author(s) : Walsh SB , Dolden TA , Moores GD , Kristensen M , Lewis T , Devonshire AL , Williamson MS |
| Ref : Biochemical Journal , 359 :175 , 2001 |
| Abstract : |
| PubMedSearch : Walsh_2001_Biochem.J_359_175 |
| PubMedID: 11563981 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Fenitroxon insensitive acetylcholinesterases of the housefly, Musca domestica associated with point mutations - Kozaki_2001_Insect.Biochem.Mol.Biol_31_991 |
| Author(s) : Kozaki T , Shono T , Tomita T , Kono Y |
| Ref : Insect Biochemistry & Molecular Biology , 31 :991 , 2001 |
| Abstract : |
| PubMedSearch : Kozaki_2001_Insect.Biochem.Mol.Biol_31_991 |
| PubMedID: 11483435 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Identification and characterization of mutations in housefly (Musca domestica) acetylcholinesterase involved in insecticide resistance - Walsh_2001_Biochem.J_359_175 |
| Author(s) : Walsh SB , Dolden TA , Moores GD , Kristensen M , Lewis T , Devonshire AL , Williamson MS |
| Ref : Biochemical Journal , 359 :175 , 2001 |
| Abstract : |
| PubMedSearch : Walsh_2001_Biochem.J_359_175 |
| PubMedID: 11563981 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Characterization of the acetylcholinesterase gene from insecticide-resistant houseflies (Musca domestica) - Huang_1997_Chin.J.Biotechnol_13_177 |
| Author(s) : Huang Y , Qiao C , Williamson MS , Devonshire AL |
| Ref : Chin J Biotechnol , 13 :177 , 1997 |
| Abstract : |
| PubMedSearch : Huang_1997_Chin.J.Biotechnol_13_177 |
| PubMedID: 9429779 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Characterization of the acetylcholinesterase gene from insecticide-resistant houseflies (Musca domestica) - Huang_1997_Chin.J.Biotechnol_13_177 |
| Author(s) : Huang Y , Qiao C , Williamson MS , Devonshire AL |
| Ref : Chin J Biotechnol , 13 :177 , 1997 |
| Abstract : |
| PubMedSearch : Huang_1997_Chin.J.Biotechnol_13_177 |
| PubMedID: 9429779 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Characterization of the acetylcholinesterase gene from insecticide-resistant houseflies (Musca domestica) - Huang_1997_Chin.J.Biotechnol_13_177 |
| Author(s) : Huang Y , Qiao C , Williamson MS , Devonshire AL |
| Ref : Chin J Biotechnol , 13 :177 , 1997 |
| Abstract : |
| PubMedSearch : Huang_1997_Chin.J.Biotechnol_13_177 |
| PubMedID: 9429779 |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Altered Forms of Acetylcholinesterase in Insecticide-Resistant Houseflies (Musca Domestica) - |
| Author(s) : Williamson MS , Moores GD |
| Ref : In Multidisciplinary approaches to cholinesterase functions - Proceedings of Fourth International Meeting on Cholinesterases , (Shafferman, A. and Velan, B., Eds) Plenum Press, New York :83 , 1992 |
| PubMedID: |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Altered Forms of Acetylcholinesterase in Insecticide-Resistant Houseflies (Musca Domestica) - |
| Author(s) : Williamson MS , Moores GD |
| Ref : In Multidisciplinary approaches to cholinesterase functions - Proceedings of Fourth International Meeting on Cholinesterases , (Shafferman, A. and Velan, B., Eds) Plenum Press, New York :83 , 1992 |
| PubMedID: |
| Gene_locus related to this paper: musdo-ACHE |
| Title : Altered Forms of Acetylcholinesterase in Insecticide-Resistant Houseflies (Musca Domestica) - |
| Author(s) : Williamson MS , Moores GD |
| Ref : In Multidisciplinary approaches to cholinesterase functions - Proceedings of Fourth International Meeting on Cholinesterases , (Shafferman, A. and Velan, B., Eds) Plenum Press, New York :83 , 1992 |
| PubMedID: |
| Gene_locus related to this paper: musdo-ACHE |