phera-PrKAI2d1

Phelipanche ramosa (Hemp broomrape) (Orobanche ramosa) parasitic plant PrKAI2d1

Comment

"Other strains: Phelipanche ramosa (Hemp broomrape) (Orobanche ramosa) parasitic plant\; Phelipanche aegyptiaca"

Relationship

Family : RsbQ-like

Block : X

Position in NCBI Life Tree : Phelipanche ramosa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSPLGDAHNVRVLGSGERTVVLSHGYGTDQSIWRQLVPHL
VDDFRVVLYD NMGSGPTNPDYFDFERYATLEGYAHDLIA
ILMEFSFGKCIYVGHSLSAMA GLYASILRPDMFHKMIML
SATPRMLNEIDYHGGFEQKDLDQLLDMGIQNY KLLESGR
APLMIAGDMDSEVMQEFCRTLFNMRPDISLSLVHTMHTYD
MRP FLKDVTVPCHIIQSSKDWAVPVKVSRYLQENIGAKS
TVEVMSTEGHLPHL SAPEVTIPVLLRHIHHDIADA

References

Title : A Phelipanche ramosa KAI2 protein perceives strigolactones and isothiocyanates enzymatically - de Saint Germain_2021_Plant.Commun_2_100166
Author(s) : de Saint Germain A , Jacobs A , Brun G , Pouvreau JB , Braem L , Cornu D , Clave G , Baudu E , Steinmetz V , Servajean V , Wicke S , Gevaert K , Simier P , Goormachtig S , Delavault P , Boyer FD
Ref : Plant Commun , 2 :100166 , 2021
Abstract : de Saint Germain_2021_Plant.Commun_2_100166
ESTHER : de Saint Germain_2021_Plant.Commun_2_100166
PubMedSearch : de Saint Germain_2021_Plant.Commun_2_100166
PubMedID: 34746757
Gene_locus related to this paper: phera-PrKAI2c , phera-PrKAI2d1 , phera-PrKAI2d2 , phera-PrKAI2d3 , phera-PrKAI2d4