sphsx-DspxA

unclassified Sphingomonas Haloalkane dehalogenase HLD2 DspxA

Comment

Relationship

Family : Haloalkane_dehalogenase-HLD2

Block : X

Position in NCBI Life Tree : unclassified Sphingomonas

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MTDIANAQPFHSLATREILGRRMAYIDYGAGRPIVFQHGN
PTSSYLWRNV MRGCDGLGRLIACDLIGMGGSDKIEGEGD
ARYGWDVHYAHLDALWQSLDL GDGIVLVLHDWGSALGFQ
WAMDHPERVAGIVYMEAIVGPMTWSEWPEGGR RMFQGFR
SEAGESLILDRNLFIDRVLPGSILRALSDDEMAHYRAPYP
DPG EARRPMLAWPRLLPVDGEPADFVERARNYGEFLRTS
SIPKLFINADPGSI LVGSAREYCRSWANQREITVPGLHF
IQEDSAAEIATGIRALVRELNAE

References