mycua-a0pum4

Mycobacterium ulcerans (strain Agy99) Mycobacterium marinum (strain ATCC BAA-535 / M) Haloalkane dehalogenase 2 DhaA DmmarA DmuA

Comment

Relationship

Family : Haloalkane_dehalogenase-HLD2

Block : X

Position in NCBI Life Tree : Mycobacterium ulcerans

Molecular evidence

No mutation

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKRVDVLDSAMSYIDVGQGDPIVFLHGNPTSSYLWRNVIP
HLSDVGRCLA PDLIGMGASGTSPTFSYQFADHVRYLDAW
FEAVGITENVVLVVHDWGSAL GFYRALRYPEQIAGIAYM
DAPVQPRTWAGFTDYEPLMRALRTEQGERMAL AENVFVE
KVVPGGVQRQLTEEEMAVYRKPYPTPQSRIPTLLWAREIP
VEG EPADVQAMVQEYADFLSRSDIPKLLIVAEPGAILHE
GGSELDFARSWPNQ REVKVAGRHFLQEDSPDAIGAAVRA
FVLDVRERQDGADRA

References

Title : Insights from the complete genome sequence of Mycobacterium marinum on the evolution of Mycobacterium tuberculosis - Stinear_2008_Genome.Res_18_729
Author(s) : Stinear TP , Seemann T , Harrison PF , Jenkin GA , Davies JK , Johnson PD , Abdellah Z , Arrowsmith C , Chillingworth T , Churcher C , Clarke K , Cronin A , Davis P , Goodhead I , Holroyd N , Jagels K , Lord A , Moule S , Mungall K , Norbertczak H , Quail MA , Rabbinowitsch E , Walker D , White B , Whitehead S , Small PL , Brosch R , Ramakrishnan L , Fischbach MA , Parkhill J , Cole ST
Ref : Genome Res , 18 :729 , 2008
Abstract : Stinear_2008_Genome.Res_18_729
ESTHER : Stinear_2008_Genome.Res_18_729
PubMedSearch : Stinear_2008_Genome.Res_18_729
PubMedID: 18403782
Gene_locus related to this paper: mycmm-b2hds9 , mycmm-b2hed7 , mycmm-b2hg81 , mycmm-b2hgg2 , mycmm-b2hgg7 , mycmm-b2hhi7 , mycmm-b2hhu3 , mycmm-b2hiu3 , mycmm-b2hiu5 , mycmm-b2hiw7 , mycmm-b2hiy0 , mycmm-b2hj55 , mycmm-b2hjb4 , mycmm-b2hju3 , mycmm-b2hku1 , mycmm-b2hkw0 , mycmm-b2hlr0 , mycmm-b2hlt7 , mycmm-b2hlt8 , mycmm-b2hlt9 , mycmm-b2hlu0 , mycmm-b2hlv0 , mycmm-b2hlv1 , mycmm-b2hlv2 , mycmm-b2hlx2 , mycmm-b2hm55 , mycmm-b2hnr9 , mycmm-b2hnz5 , mycmm-b2hp80 , mycmm-b2hpp0 , mycmm-b2hq96 , mycmm-b2hr10 , mycmm-b2hsm6 , mycmm-b2hsm8 , mycmm-b2hsy0 , mycmm-b2ht06 , mycmm-b2ht20 , mycmm-b2ht49 , mycmm-dhma , mycmm-metx , mycmr-q5sdq4 , myctu-RV1683 , mycmm-b2h1k1 , mycua-a0pku2 , mycua-a0pl47 , mycua-a0plr3 , mycua-a0pm12 , mycua-a0pm14 , mycua-a0pmv0 , mycua-a0pmx9 , mycua-a0pn71 , mycua-a0ppm6 , mycua-a0pqm2 , mycua-a0pqs2 , mycua-a0prq2 , mycua-a0psb1 , mycua-a0psb4 , mycua-a0psi2 , mycua-a0pth6 , mycua-a0ptq0 , mycua-a0pu55 , mycua-a0pum4 , mycua-a0pv11 , mycua-a0pva4 , mycua-a0pwi8 , mycua-a0pwr6 , mycua-a0pwz5 , mycul-a85a , mycmm-b2hcy1 , mycua-a0pvg7 , mycmm-b2hnj4 , mycmm-b2he93 , mycua-a0pwz4 , mycmm-b2hqy3 , mycua-a0pmc3 , mycmm-b2hnn7 , mycmm-b2he68 , mycmm-b2hqm3 , mycmm-tesa

Title : Reductive evolution and niche adaptation inferred from the genome of Mycobacterium ulcerans, the causative agent of Buruli ulcer - Stinear_2007_Genome.Res_17_192
Author(s) : Stinear TP , Seemann T , Pidot S , Frigui W , Reysset G , Garnier T , Meurice G , Simon D , Bouchier C , Ma L , Tichit M , Porter JL , Ryan J , Johnson PD , Davies JK , Jenkin GA , Small PL , Jones LM , Tekaia F , Laval F , Daffe M , Parkhill J , Cole ST
Ref : Genome Res , 17 :192 , 2007
Abstract : Stinear_2007_Genome.Res_17_192
ESTHER : Stinear_2007_Genome.Res_17_192
PubMedSearch : Stinear_2007_Genome.Res_17_192
PubMedID: 17210928
Gene_locus related to this paper: mycmm-b2hds9 , mycmm-b2hg81 , mycmm-b2hgg2 , mycmm-b2hj55 , mycmm-b2hju3 , mycmm-b2hlr0 , mycmm-b2hlv2 , mycmm-b2hq96 , mycmm-b2hsm8 , mycmr-q5sdq4 , myctu-RV1683 , mycua-a0pkg7 , mycua-a0pki1 , mycua-a0pkn2 , mycua-a0pkn5 , mycua-a0pku2 , mycua-a0pl47 , mycua-a0plr3 , mycua-a0plu8 , mycua-a0ply4 , mycua-a0pm12 , mycua-a0pm14 , mycua-a0pme3 , mycua-a0pmj6 , mycua-a0pml9 , mycua-a0pmv0 , mycua-a0pmx9 , mycua-a0pn71 , mycua-a0png7 , mycua-a0png9 , mycua-a0pp56 , mycua-a0ppm6 , mycua-a0pqm2 , mycua-a0pqs2 , mycua-a0pr64 , mycua-a0pr98 , mycua-a0prq2 , mycua-a0prr7 , mycua-a0psb1 , mycua-a0psb4 , mycua-a0psi2 , mycua-a0psi3 , mycua-a0psu3 , mycua-a0pt08 , mycua-a0pt71 , mycua-a0pth6 , mycua-a0ptq0 , mycua-a0pu55 , mycua-a0pum4 , mycua-a0pv11 , mycua-a0pv36 , mycua-a0pv77 , mycua-a0pva4 , mycua-a0pwi8 , mycua-a0pwm4 , mycua-a0pwr6 , mycua-a0pwz5 , mycua-a0px52 , mycua-metx , mycua-a0pmc2 , mycua-a0pvg7 , mycua-a0pwz4 , mycmm-b2hqy3 , mycua-a0pmc3