Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9alte-a3jb27

Marinobacter sp. ELB17 psychrophilic bacterium paradoxically high thermostability haloalkane dehalogenase DmxA

Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Marinobacter sp. ELB17
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Alteromonadaceae: N E > Marinobacter: N E > Marinobacter sp. ELB17: N E


Molecular evidence
Database
No mutation
1 structure:
5MXP: Haloalkane dehalogenase DmxA from Marinobacter sp. ELB17 possessing a unique catalytic residue
No kinetic





No Substrate
No inhibitor
1 Genbank : AAXY01000003
1 UniProt : A3JB27
1 Structure : 5MXP
1 UniProt : A3JB27
1 Interpro : A3JB27
1 Prodom : A3JB27
1 Pfam : A3JB27
1 PIRSF : A3JB27
1 SUPERFAM : A3JB27
Sequence
Graphical view for this peptide sequence: 9alte-a3jb27
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MTTQKPADFPYPSHFADVLGSRMHYVEHGNGDPLLFLHGQPTWSYLWRKV
LPELEGKGRLIAVDLIGYGMSDKPDIPYDIDDHIRYLDGFIEALGLDRIT
IVCHDWGSFFGFHYAHRHPERIKGLAFMEAMLNPIPGYDAFDPQTRAFFQ
TLRSSQANAERMMMDENQFVENILPAMICRPLERQELDAYRAPWTDRQSR
RILCTFPQNLCIGKEPASVYRMQTAYIEWLGQTDLPKLLIHAEPGFLIPA
PAVDQYRQQLPNLETAFVGSGLHYIQEDQPQKIGQAIAQWMDRCGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTQKPADFPYPSHFADVLGSRMHYVEHGNGDPLLFLHGQPTWSYLWRKV
LPELEGKGRLIAVDLIGYGMSDKPDIPYDIDDHIRYLDGFIEALGLDRIT
IVCHDWGSFFGFHYAHRHPERIKGLAFMEAMLNPIPGYDAFDPQTRAFFQ
TLRSSQANAERMMMDENQFVENILPAMICRPLERQELDAYRAPWTDRQSR
RILCTFPQNLCIGKEPASVYRMQTAYIEWLGQTDLPKLLIHAEPGFLIPA
PAVDQYRQQLPNLETAFVGSGLHYIQEDQPQKIGQAIAQWMDRCGL


References
    Title: Deciphering the Structural Basis of High Thermostability of Dehalogenase from Psychrophilic Bacterium Marinobacter sp. ELB17
    Chrast L, Tratsiak K, Planas-Iglesias J, Daniel L, Prudnikova T, Brezovsky J, Bednar D, Kuta Smatanova I, Chaloupkova R, Damborsky J
    Ref: Microorganisms, 7:, 2019 : PubMed

            

    Title: Crystallographic analysis of new psychrophilic haloalkane dehalogenases: DpcA from Psychrobacter cryohalolentis K5 and DmxA from Marinobacter sp. ELB17
    Tratsiak K, Degtjarik O, Drienovska I, Chrast L, Rezacova P, Kuty M, Chaloupkova R, Damborsky J, Kuta Smatanova I
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 69:683, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer