Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciba-d0c992

Acinetobacter baumannii, Acinetobacter calcoaceticus, Acinetobacter sp;, S-formylglutathione hydrolase

Comment
There are more than 600 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii ATCC 19606
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E > Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: GG704573, GG704954, GG704526
>3 UniProt links 2 more: D0C992, D0S7P6, B0V7R1
>3 UniProt links 2 more: D0C992, D0S7P6, B0V7R1
>3 Interpro links 2 more: D0C992, D0S7P6, B0V7R1
>3 Prodom links 2 more: D0C992, D0S7P6, B0V7R1
>3 Pfam links 2 more: D0C992, D0S7P6, B0V7R1
>3 PIRSF links 2 more: D0C992, D0S7P6, B0V7R1
>3 SUPERFAM links 2 more: D0C992, D0S7P6, B0V7R1
Sequence
Graphical view for this peptide sequence: aciba-d0c992
Colored MSA for A85-EsteraseD-FGH (raw)
MLRHKQRLKTMQLLQKNRCFEGEQRIYQFDSQLLKGSTKFGVYLPPAALE
GKPCSTLFYLAGLTCTEETFAIKAHAQHMAAQLSLILITPDTSPRGEQVA
VGDNWDLGQGAGFYINATEAPWSEHYQMESYLIDELYPLILKSFPVNAQQ
VGIFGHSMGGHGALTLAFKYPEKFKSVSAFAPICAPTECAWGDKAFSHYL
GADRESWLAHDATALVSKNGAVFDEILVDQGLDDQFYEQLHPEKFKQACL
KAGQPLTLRQHAGYDHGYYFIQTFMDEHLQFHAIQLEKVSG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRHKQRLKTMQLLQKNRCFEGEQRIYQFDSQLLKGSTKFGVYLPPAALE
GKPCSTLFYLAGLTCTEETFAIKAHAQHMAAQLSLILITPDTSPRGEQVA
VGDNWDLGQGAGFYINATEAPWSEHYQMESYLIDELYPLILKSFPVNAQQ
VGIFGHSMGGHGALTLAFKYPEKFKSVSAFAPICAPTECAWGDKAFSHYL
GADRESWLAHDATALVSKNGAVFDEILVDQGLDDQFYEQLHPEKFKQACL
KAGQPLTLRQHAGYDHGYYFIQTFMDEHLQFHAIQLEKVSG


References
3 more
    Title: Comparative genome sequence analysis of multidrug-resistant Acinetobacter baumannii
    Adams MD, Goglin K, Molyneaux N, Hujer KM, Lavender H, Jamison JJ, MacDonald IJ, Martin KM, Russo T and Gill SR <3 more author(s)>
    Ref: Journal of Bacteriology, 190:8053, 2008 : PubMed

            

    Title: Whole-genome pyrosequencing of an epidemic multidrug-resistant Acinetobacter baumannii strain belonging to the European clone II group
    Iacono M, Villa L, Fortini D, Bordoni R, Imperi F, Bonnal RJ, Sicheritz-Ponten T, De Bellis G, Visca P and Carattoli A <1 more author(s)>
    Ref: Antimicrobial Agents & Chemotherapy, 52:2616, 2008 : PubMed

            

    Title: Comparative analysis of Acinetobacters: three genomes for three lifestyles
    Vallenet D, Nordmann P, Barbe V, Poirel L, Mangenot S, Bataille E, Dossat C, Gas S, Kreimeyer A and Cruveiller S <10 more author(s)>
    Ref: PLoS ONE, 3:e1805, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer