Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciba-k6lkl9

Acinetobacter baumannii OIFC099 Alpha/beta hydrolase family protein

Comment
Other strains: Acinetobacter baumannii OIFC099; ABNIH26; ABNIH24; ABNIH19; ABNIH11; NIPH 190; NIPH 528; ABNIH7; OIFC087; IS-116; NIPH 1669; ABNIH10; 6013150; 6013113; ABNIH25; NIPH 80; WC-A-92; ABNIH16; NIPH 410 Canada BC1; OIFC338; ANC 4097 ABNIH4; NIPH 24; NIPH 527; ABNIH18; ABNIH23; WC-348; OIFC035; AB210; Naval-82; ABNIH13; 6014059; ABNIH5; NIPH 2061; WC-A-694; ABNIH6; Naval-57; NIPH 329; Naval-113; Naval-78; NIPH 60; ABNIH15; ABNIH20; OIFC065; NIPH 70; Naval-2; NIPH 201; ABNIH17; NIPH 1362; SDF;AYE; TCDC-AB0715; AB307-0294; ATCC 17978 / NCDC KC 755; 1656-2; ACICU; NIPH 290; ABNIH14; ABNIH22;WC-136


Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii OIFC099
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E > Acinetobacter baumannii OIFC099: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4OPM: Crystal structure of a putative lipase (lip1) from Acinetobacter baumannii AYE at 1.70 A resolution
No kinetic





No Substrate
No inhibitor
>3 Genbank links 58 more: AMFT01000016, AOGD01000071, APBL01000001
>3 UniProt links 2 more: N9KM21, S3TKZ6, B0VSR2
1 Structure : 4OPM
>3 UniProt links 2 more: N9KM21, S3TKZ6, B0VSR2
>3 Interpro links 2 more: N9KM21, S3TKZ6, B0VSR2
>3 Pfam links 2 more: N9KM21, S3TKZ6, B0VSR2
>3 PIRSF links 2 more: N9KM21, S3TKZ6, B0VSR2
>3 SUPERFAM links 2 more: N9KM21, S3TKZ6, B0VSR2
Sequence
Graphical view for this peptide sequence: aciba-k6lkl9
Colored MSA for ABHD6-Lip (raw)
MTRLSASIKVSMKKTATAMTLACSLLSVMSISQAQAADNIDVSFQTILQQ
ERNWAGLQSKSLKVGDITWSYSEGGSSTKPTLLLIHGLAGSRDNWNRVAH
YLTTNYHVIIPDLPGSGETIVSQDFDYSVPNLAEKLRRFVEAANLKGPIH
IAGHSLGGSIALLYAGQYPFETKSLFLVDSGGIFRSANTIYLKDPTYLKQ
LLVSKKGDFNYLLKQTMFNPPFIPKEFLQAQEKLMINQAPQTQKLVDQLI
ALNKVYTPDSFAVLTKTIDAPTLILWGKQDKIINVEVANELKRLLKNAQP
PVILENVGHMPILEAEQLVIQQYVPFLLKVETNQSSKTTTP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRLSASIKVSMKKTATAMTLACSLLSVMSISQAQAADNIDVSFQTILQQ
ERNWAGLQSKSLKVGDITWSYSEGGSSTKPTLLLIHGLAGSRDNWNRVAH
YLTTNYHVIIPDLPGSGETIVSQDFDYSVPNLAEKLRRFVEAANLKGPIH
IAGHSLGGSIALLYAGQYPFETKSLFLVDSGGIFRSANTIYLKDPTYLKQ
LLVSKKGDFNYLLKQTMFNPPFIPKEFLQAQEKLMINQAPQTQKLVDQLI
ALNKVYTPDSFAVLTKTIDAPTLILWGKQDKIINVEVANELKRLLKNAQP
PVILENVGHMPILEAEQLVIQQYVPFLLKVETNQSSKTTTP


References
5 more
    Title: Genomic insights into the fate of colistin resistance and Acinetobacter baumannii during patient treatment
    Snitkin ES, Zelazny AM, Gupta J, Palmore TN, Murray PR, Segre JA
    Ref: Genome Res, 23:1155, 2013 : PubMed

            

    Title: Whole-genome comparison of two Acinetobacter baumannii isolates from a single patient, where resistance developed during tigecycline therapy
    Hornsey M, Loman N, Wareham DW, Ellington MJ, Pallen MJ, Turton JF, Underwood A, Gaulton T, Thomas CP and Woodford N <2 more author(s)>
    Ref: J Antimicrob Chemother, 66:1499, 2011 : PubMed

            

    Title: Genome-wide recombination drives diversification of epidemic strains of Acinetobacter baumannii
    Snitkin ES, Zelazny AM, Montero CI, Stock F, Mijares L, Murray PR, Segre JA
    Ref: Proc Natl Acad Sci U S A, 108:13758, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer