Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfu-q6my76

Neosartorya fumigata (Aspergillus fumigatus) (Sartorya fumigata) (and strain Af293) hypothetical protein

Comment
Other strains: Neosartorya fumigata (Aspergillus fumigatus) (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100; CEA10 / CBS 144.89 / FGSC A1163) Only central part Pfam A Abhydrolase_2 226 328


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Aspergillus fumigatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BX649607, AAHF01000004
3 UniProt : Q6MY76, Q4WS37, B0XMP3
3 UniProt : Q6MY76, Q4WS37, B0XMP3
3 Interpro : Q6MY76, Q4WS37, B0XMP3
3 Prodom : Q6MY76, Q4WS37, B0XMP3
3 Pfam : Q6MY76, Q4WS37, B0XMP3
3 PIRSF : Q6MY76, Q4WS37, B0XMP3
3 SUPERFAM : Q6MY76, Q4WS37, B0XMP3
Sequence
Graphical view for this peptide sequence: aspfu-q6my76
Colored MSA for LYsophospholipase_carboxylesterase (raw)
HVYFPSNPSHTSTVILLHDTNSTGAELAAALDVSTTPATETATAGNPKSI
FEHFPSCRWVFPSAQPRQIDICYASRGNWINVDVDVAVAVDTDANEDTDP
GANSLQQPQPQLSPSTKDVDNNYNNNADQNDDLETCVEYILQVVEEEIIR
LDGDSRRVVLGGFGQGMAVAIAALLAAQRRLGGFVGVSGWVPHPERIGSL
AGRGRGLLVENEARMGASEGSAGADGVEVDPGADSMLETPVLLSYLEDDP
CVDIQTALTVDETL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

HVYFPSNPSHTSTVILLHDTNSTGAELAAALDVSTTPATETATAGNPKSI
FEHFPSCRWVFPSAQPRQIDICYASRGNWINVDVDVAVAVDTDANEDTDP
GANSLQQPQPQLSPSTKDVDNNYNNNADQNDDLETCVEYILQVVEEEIIR
LDGDSRRVVLGGFGQGMAVAIAALLAAQRRLGGFVGVSGWVPHPERIGSL
AGRGRGLLVENEARMGASEGSAGADGVEVDPGADSMLETPVLLSYLEDDP
CVDIQTALTVDETL


Reference
    Title: Insight into the genome of Aspergillus fumigatus: analysis of a 922 kb region encompassing the nitrate assimilation gene cluster
    Pain A, Woodward J, Quail MA, Anderson MJ, Clark R, Collins M, Fosker N, Fraser A, Harris D and Hall N <15 more author(s)>
    Ref: Fungal Genet Biol, 41:443, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer