Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspkw-g7xy77

Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus niger Carboxylesterase

Comment
Other strain: Aspergillus niger; Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Aspergillus kawachii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus kawachii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DF126485
1 UniProt : G7XY77
3 UniProt : G7XY77, A0A100IQK6, A0A146F4G8
3 Interpro : G7XY77, A0A100IQK6, A0A146F4G8
3 Pfam : G7XY77, A0A100IQK6, A0A146F4G8
3 PIRSF : G7XY77, A0A100IQK6, A0A146F4G8
3 SUPERFAM : G7XY77, A0A100IQK6, A0A146F4G8
Sequence
Graphical view for this peptide sequence: aspkw-g7xy77
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MNQSRRARLALVTLIPSLIGANAALCDTVIKTQYGGVQGYPAFTSEPAGN
LTHWKDITVWKNIPFAATTGGQNRWKAPQPASPWNGTLDAKSYGNVCPSA
TEGSSDYTIDEDCLNLNIWSPANSSDAKLPVVMWSYPALSTAADALFDGG
GMADQGIVYVNYNYRTGSFGWLAHPELSEEFYKVTGSNSSGNWGMLDQFA
ALKWIHENIAAFGGDPEHITVMGQSAGSAATQHILNSPLTKGLIVGAIIE
SGVRDPHDPLCTSLAEGYSTLEDQLAQGERFMASVNCSSIAEMRELPMED
LVVSGGTFGSTSEWSFGATLDYYAMPDTYYNTLIKGLAQDVPIITGNTKD
ESGASYGLNLTISEYLADMNETFSEPWLSRFLEQYPGNTTRTAPGAYNSQ
WTDRSKVGTWLWAQLWATARTSPVYTYFWDHAPPGQDQGAYHESEINYVL
NNLYGTDMPWTAADYSIARKMNGYWANFIKTGNPNGGSLAQWPATGENAT
VQHVGDGWGEIPTASDAKVKLFEEWFET
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNQSRRARLALVTLIPSLIGANAALCDTVIKTQYGGVQGYPAFTSEPAGN
LTHWKDITVWKNIPFAATTGGQNRWKAPQPASPWNGTLDAKSYGNVCPSA
TEGSSDYTIDEDCLNLNIWSPANSSDAKLPVVMWSYPALSTAADALFDGG
GMADQGIVYVNYNYRTGSFGWLAHPELSEEFYKVTGSNSSGNWGMLDQFA
ALKWIHENIAAFGGDPEHITVMGQSAGSAATQHILNSPLTKGLIVGAIIE
SGVRDPHDPLCTSLAEGYSTLEDQLAQGERFMASVNCSSIAEMRELPMED
LVVSGGTFGSTSEWSFGATLDYYAMPDTYYNTLIKGLAQDVPIITGNTKD
ESGASYGLNLTISEYLADMNETFSEPWLSRFLEQYPGNTTRTAPGAYNSQ
WTDRSKVGTWLWAQLWATARTSPVYTYFWDHAPPGQDQGAYHESEINYVL
NNLYGTDMPWTAADYSIARKMNGYWANFIKTGNPNGGSLAQWPATGENAT
VQHVGDGWGEIPTASDAKVKLFEEWFET


Reference
    Title: Genome sequence of the white koji mold Aspergillus kawachii IFO 4308, used for brewing the Japanese distilled spirit shochu
    Futagami T, Mori K, Yamashita A, Wada S, Kajiwara Y, Takashita H, Omori T, Takegawa K, Tashiro K and Goto M <1 more author(s)>
    Ref: Eukaryot Cell, 10:1586, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer