Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bact6-e6str2

Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / 36-108) Acetyl xylan esterase

Comment
only c-term Pfam A AXE1 110 409


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Bacteroides helcogenes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Bacteroidaceae: N E > Bacteroides: N E > Bacteroides helcogenes: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002352
1 UniProt : E6STR2
1 UniProt : E6STR2
1 Interpro : E6STR2
1 Prodom : E6STR2
1 Pfam : E6STR2
1 PIRSF : E6STR2
1 SUPERFAM : E6STR2
Sequence
Graphical view for this peptide sequence: bact6-e6str2
Colored MSA for Acetyl-esterase_deacetylase (raw)
GQLQPVTELPADFRDYWEKTLENARTTPLNPVMTLLPERCTETDNVYQVS
FRTKAWGGRFYGILSIPRKEGKYPALLRVPGAGVRPYTGDTYTAPGKVIT
LEVGVHGIPVTMQQSVYDALADGALNNYCTFGRDNRDAFYYNRVIVGALR
AVDFICSLPQYNGRALGVTGSSQGGALSVITAALDPRVTFFAAVHPALCD
HEAALKKRACGWPHYFYCNGAPDEKELETVRYYDTANFARLLNVPGWFSW
GYNDEVCPPTSMYAAYNVITSPKELHPYLETGHYWYQEQWDEWLEWLRKQ
LQNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GQLQPVTELPADFRDYWEKTLENARTTPLNPVMTLLPERCTETDNVYQVS
FRTKAWGGRFYGILSIPRKEGKYPALLRVPGAGVRPYTGDTYTAPGKVIT
LEVGVHGIPVTMQQSVYDALADGALNNYCTFGRDNRDAFYYNRVIVGALR
AVDFICSLPQYNGRALGVTGSSQGGALSVITAALDPRVTFFAAVHPALCD
HEAALKKRACGWPHYFYCNGAPDEKELETVRYYDTANFARLLNVPGWFSW
GYNDEVCPPTSMYAAYNVITSPKELHPYLETGHYWYQEQWDEWLEWLRKQ
LQNL


Reference
    Title: Complete genome sequence of Bacteroides helcogenes type strain (P 36-108)
    Pati A, Gronow S, Zeytun A, Lapidus A, Nolan M, Hammon N, Deshpande S, Cheng JF, Tapia R and Lucas S <24 more author(s)>
    Ref: Stand Genomic Sci, 4:45, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer