Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brume-BMEII0306

Brucella melitensis carboxylesterase (EC 3.1.1.1)

Comment
previously 5_AlphaBeta_hydrolase


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Brucella melitensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella melitensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE009669
1 UniProt : Q8YD71
1 Interpro : Q8YD71
1 Pfam : Q8YD71
1 PIRSF : Q8YD71
1 SUPERFAM : Q8YD71
Sequence
Graphical view for this peptide sequence: brume-BMEII0306
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MDTDVTPEQNFSRSKQFIYRFYKPENASNELIVLLHGSGGNETSLVPLAT
KIWPRATLLGIRGRVMQDGDTRWYRRITPVKFDQKDVKLEANAFVTFLTR
LADNKDLDLAHATFVGYSNGANLLAATMLLHPDLVKRAVLMRSMPVLDDA
PVANLGKAHVLTIAGEHDKLYSPYAPALSAILRASGARVDARTIDADHML
GEKDIATIRQWVDSLGPDGGPTVSMKAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDTDVTPEQNFSRSKQFIYRFYKPENASNELIVLLHGSGGNETSLVPLAT
KIWPRATLLGIRGRVMQDGDTRWYRRITPVKFDQKDVKLEANAFVTFLTR
LADNKDLDLAHATFVGYSNGANLLAATMLLHPDLVKRAVLMRSMPVLDDA
PVANLGKAHVLTIAGEHDKLYSPYAPALSAILRASGARVDARTIDADHML
GEKDIATIRQWVDSLGPDGGPTVSMKAR


Reference
    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer