Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: candc-b9wdh9

Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCP 3949 / NRRL Y-17841) (Yeast) Putative uncharacterized protein

Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Candida dubliniensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida dubliniensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FM992690
1 UniProt : B9WDH9
1 UniProt : B9WDH9
1 Interpro : B9WDH9
1 Pfam : B9WDH9
1 PIRSF : B9WDH9
1 SUPERFAM : B9WDH9
Sequence
Graphical view for this peptide sequence: candc-b9wdh9
Colored MSA for Duf_1749 (raw)
MSLKSVPQQKGIVHTYGFNLTAFEFTTSDSKKTSPNVILFVGGLGNGLLN
VPYLPQLADSASNEFQSADGGSWSLVQVLLSSAYQGWGTSSLDRDAFELQ
SAIEYFRSERGGNRQKIVIMGHSTGCQDVIHYLTKTLYKENIPETSQVQG
GILQAPVSDSEALSSGRDPAKYEALIQRVYEEYISKGRENEILPQEYRKI
TWGMPTSAYRFYSLASKRGDDDYFSSYLTEDDYKNSFGKVNKPLLVLYGS
IDEFVPEYVDKEKLVSKWKQSTPSQYWSEHSQIIKGATHNLGDGSDAGVI
DYLVSVVKKFISDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLKSVPQQKGIVHTYGFNLTAFEFTTSDSKKTSPNVILFVGGLGNGLLN
VPYLPQLADSASNEFQSADGGSWSLVQVLLSSAYQGWGTSSLDRDAFELQ
SAIEYFRSERGGNRQKIVIMGHSTGCQDVIHYLTKTLYKENIPETSQVQG
GILQAPVSDSEALSSGRDPAKYEALIQRVYEEYISKGRENEILPQEYRKI
TWGMPTSAYRFYSLASKRGDDDYFSSYLTEDDYKNSFGKVNKPLLVLYGS
IDEFVPEYVDKEKLVSKWKQSTPSQYWSEHSQIIKGATHNLGDGSDAGVI
DYLVSVVKKFISDL


Reference
    Title: Comparative genomics of the fungal pathogens Candida dubliniensis and Candida albicans
    Jackson AP, Gamble JA, Yeomans T, Moran GP, Saunders D, Harris D, Aslett M, Barrell JF, Butler G and Berriman M <16 more author(s)>
    Ref: Genome Res, 19:2231, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer