Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: colp3-q47v81

Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) protease II (EC 3.4.21.83)

Relationship
Family|S9N_PREPL_Peptidase_S9
Block| X
Position in NCBI Life Tree|Colwellia psychrerythraea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Colwelliaceae: N E > Colwellia: N E > Colwellia psychrerythraea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000083
1 UniProt : Q47V81
1 UniProt : Q47V81
1 Interpro : Q47V81
1 Pfam : Q47V81
1 PIRSF : Q47V81
1 SUPERFAM : Q47V81
Sequence
Graphical view for this peptide sequence: colp3-q47v81
Colored MSA for S9N_PREPL_Peptidase_S9 (raw)
MSQILSKTKLSLIVSSALLIAACSNQNNEATNAMNDITAPIAKKVPHKMV
IHNHTRVDDYYWMRDDSRKNPEVLAHLAAENDYMKAQLQHTEAMQEKIFQ
EIKARIEKDDSSVPTKKGYFYYASQMQGENEYPIYVRSSDFSGSNLEVLL
NVNELAKAHDYYQVSGLSASPDGKLLAYGEDTVSRRIYTVQFKDIAGKTL
LDDRLEGTNGGIVWGNDNKTVYYIKKDPQTLLGYQVFRHTLGTPQATDEM
VYEESNKAYYTGLSKSKDGSSVFIWHSSTEASGVSVIDADNAKAMPKKFI
EREEGHEYSISKMNDWYYINTNWQATNFRLMKVNKKHLGDKTQWQDVIPA
NDAVKLEDYELFANHLVYQQRENGISRLTIQELSSGKKQQLSFNDTAYTL
SLYGNNELKNNKLRLYYTSFTTPGTHYDVDLNTLDKTQLKQAKVLGDFDS
NNYASERIFVKARDGKKVPVSLVYRKDKFKKDGTNPLYQYAYGSYGHTID
PSFSVSRLSLLDRGFVYAVAHIRGSEMLGRPWYEDGKKLTKMNTFTDFID
VTKDLTAQGYGDKENVFAVGGSAGGLLMGAVINMAPEQYKGIAAAVPFVD
VVTTMLDESIPLTTNEFKEWGNPKEKTYYDYMLSYSPYDQVKAQDYPNIL
VTTGLHDSQVQYFEPMKWVAKLRDYKTDDNLLLFKTDMEAGHGGASGRFK
RIHDTALQYSFFIDLLNKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQILSKTKLSLIVSSALLIAACSNQNNEATNAMNDITAPIAKKVPHKMV
IHNHTRVDDYYWMRDDSRKNPEVLAHLAAENDYMKAQLQHTEAMQEKIFQ
EIKARIEKDDSSVPTKKGYFYYASQMQGENEYPIYVRSSDFSGSNLEVLL
NVNELAKAHDYYQVSGLSASPDGKLLAYGEDTVSRRIYTVQFKDIAGKTL
LDDRLEGTNGGIVWGNDNKTVYYIKKDPQTLLGYQVFRHTLGTPQATDEM
VYEESNKAYYTGLSKSKDGSSVFIWHSSTEASGVSVIDADNAKAMPKKFI
EREEGHEYSISKMNDWYYINTNWQATNFRLMKVNKKHLGDKTQWQDVIPA
NDAVKLEDYELFANHLVYQQRENGISRLTIQELSSGKKQQLSFNDTAYTL
SLYGNNELKNNKLRLYYTSFTTPGTHYDVDLNTLDKTQLKQAKVLGDFDS
NNYASERIFVKARDGKKVPVSLVYRKDKFKKDGTNPLYQYAYGSYGHTID
PSFSVSRLSLLDRGFVYAVAHIRGSEMLGRPWYEDGKKLTKMNTFTDFID
VTKDLTAQGYGDKENVFAVGGSAGGLLMGAVINMAPEQYKGIAAAVPFVD
VVTTMLDESIPLTTNEFKEWGNPKEKTYYDYMLSYSPYDQVKAQDYPNIL
VTTGLHDSQVQYFEPMKWVAKLRDYKTDDNLLLFKTDMEAGHGGASGRFK
RIHDTALQYSFFIDLLNKS


Reference
    Title: The psychrophilic lifestyle as revealed by the genome sequence of Colwellia psychrerythraea 34H through genomic and proteomic analyses
    Methe BA, Nelson KE, Deming JW, Momen B, Melamud E, Zhang X, Moult J, Madupu R, Nelson WC and Fraser CM <17 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 102:10913, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer