Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cyam1-m1vi61

Cyanidioschyzon merolae (strain 10D) (Red alga). Temperature sensitive supressor Bem46

Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Cyanidioschyzon merolae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Rhodophyta: N E > Bangiophyceae: N E > Cyanidiales: N E > Cyanidiaceae: N E > Cyanidioschyzon: N E > Cyanidioschyzon merolae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP006502, XP_005539243
1 UniProt : M1VI61
1 UniProt : M1VI61
1 Interpro : M1VI61
1 Prodom : M1VI61
1 Pfam : M1VI61
1 PIRSF : M1VI61
1 SUPERFAM : M1VI61
Sequence
Graphical view for this peptide sequence: cyam1-m1vi61
Colored MSA for ABHD13-BEM46 (raw)
MAAIVPILGVALGAVGLLGGALYLKQEKLLYLPQIPSRHYDAYPDQFEGL
AYEDVALRAVDGTRIHAWLVFPVRSETGQRPRVTIIYFHGNAGNLSHRLQ
DVRNLIATCQCNVLMVSYRGYGESSGTPSEQGFKLDASAAMEFCLNAGKH
AAADDSGTSTAAGRVPSARLIESDLLYVFGRSIGGAVALWLGRKYGSKLR
GVIVENTFTCIGDMIDVVFPRGLRWLKRLNRNPWNSLALVGKIRSPILFI
SGRQDELVPPSHMDALYNAARAGSCMLARMVYIPDGTHNDTWYRGGERYY
QAIADFIQETRGLRSLTD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAIVPILGVALGAVGLLGGALYLKQEKLLYLPQIPSRHYDAYPDQFEGL
AYEDVALRAVDGTRIHAWLVFPVRSETGQRPRVTIIYFHGNAGNLSHRLQ
DVRNLIATCQCNVLMVSYRGYGESSGTPSEQGFKLDASAAMEFCLNAGKH
AAADDSGTSTAAGRVPSARLIESDLLYVFGRSIGGAVALWLGRKYGSKLR
GVIVENTFTCIGDMIDVVFPRGLRWLKRLNRNPWNSLALVGKIRSPILFI
SGRQDELVPPSHMDALYNAARAGSCMLARMVYIPDGTHNDTWYRGGERYY
QAIADFIQETRGLRSLTD


References
    Title: A 100%-complete sequence reveals unusually simple genomic features in the hot-spring red alga Cyanidioschyzon merolae
    Nozaki H, Takano H, Misumi O, Terasawa K, Matsuzaki M, Maruyama S, Nishida K, Yagisawa F, Yoshida Y and Kuroiwa T <8 more author(s)>
    Ref: BMC Biol, 5:28, 2007 : PubMed

            

    Title: Genome sequence of the ultrasmall unicellular red alga Cyanidioschyzon merolae 10D
    Matsuzaki M, Misumi O, Shin IT, Maruyama S, Takahara M, Miyagishima SY, Mori T, Nishida K, Yagisawa F and Kuroiwa T <31 more author(s)>
    Ref: Nature, 428:653, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer