Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: echgr-w6vaq5

Echinococcus granulosus (Hydatid tapeworm). Neuroligin-3

Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Echinococcus granulosus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Cestoda: N E > Eucestoda: N E > Cyclophyllidea: N E > Taeniidae: N E > Echinococcus: N E > Echinococcus granulosus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : APAU02000005
1 UniProt : W6VAQ5
1 UniProt : W6VAQ5
1 Interpro : W6VAQ5
1 Pfam : W6VAQ5
1 PIRSF : W6VAQ5
1 SUPERFAM : W6VAQ5
Sequence
Graphical view for this peptide sequence: echgr-w6vaq5
Colored MSA for Neuroligin (raw)
MATTPRALVILVYLTCADQHSITVTRFPSIRNFALDGRVTVSGVEIRFSD
PKLQPVHAIYGLRYASLGGEGNSMVSRTGTAESGELYHQAAKRRFMHSVA
AFIYETPARGHLQKTGPPPECPQPRRVQPAHDTSFDEWTVRAASSTTSTH
HLLQNPQPTTQAEDCLTLNVFVPGAAIDEKMKMCTILDNNTCDFSYIADN
HCQSGAEDLNEHALPVLIFVHGDSYEHGSGNAYDFSLFSSLGSVIVVTLN
YRLGVLGFLSENIAGSTRGNFALFDLQAAIQWVYSNIHRFGGDCEQMTLM
GHSHGAALVHLFATSLLSIGPNYYGIKRLVLFDGSANAPWATSACDTDIK
SLIEANFQMQQSSSASIFDLLQDLSITSILEIQRNLSRLGLERCFSPLPR
KQQVVTVTPTLFNRVSLMYGQTEFAGSIFYQNAAIDDNVSKFMPALVYLL
EHVFQVAAYPLTDLLKYVYVQSDTWTQNDNSSDEKNKIYEIFTDALFWTP
GLATLRQHETEQEQSSEFSSAGSSRYVVHFSRAGYGDDLNLLLGAPFVSS
LHLKSSMKRRLSQSLIQYATNFIHFGDPNKHFTIPNIAQNLAKSWPAFNS
RDELSLKLFKPTVGLNEPLPPNDVLDVASAYRKRYTTFWMKIFPKIAASS
RRTPQCKGRTITHFAVPEVQYGEAAMDGYAPVPPKSTEQVSLSERPSTIY
NETVEFPSFYDTNRMAPLTTEDSKEGYNRIFLLTIVAGLSLFLINIVFTA
TFYFCHQQRKERSSGILISASEADHRENKNSQAAKLTSEMSSCYQSVVRL
PSLSSAVEAPFQLATTKMQTDFQSVAFETLHRSPNQLGQIYPPGGNQATP
MADHQIIAALDSSPKKETHMRPSARYNQANLGNGGWHYYR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATTPRALVILVYLTCADQHSITVTRFPSIRNFALDGRVTVSGVEIRFSD
PKLQPVHAIYGLRYASLGGEGNSMVSRTGTAESGELYHQAAKRRFMHSVA
AFIYETPARGHLQKTGPPPECPQPRRVQPAHDTSFDEWTVRAASSTTSTH
HLLQNPQPTTQAEDCLTLNVFVPGAAIDEKMKMCTILDNNTCDFSYIADN
HCQSGAEDLNEHALPVLIFVHGDSYEHGSGNAYDFSLFSSLGSVIVVTLN
YRLGVLGFLSENIAGSTRGNFALFDLQAAIQWVYSNIHRFGGDCEQMTLM
GHSHGAALVHLFATSLLSIGPNYYGIKRLVLFDGSANAPWATSACDTDIK
SLIEANFQMQQSSSASIFDLLQDLSITSILEIQRNLSRLGLERCFSPLPR
KQQVVTVTPTLFNRVSLMYGQTEFAGSIFYQNAAIDDNVSKFMPALVYLL
EHVFQVAAYPLTDLLKYVYVQSDTWTQNDNSSDEKNKIYEIFTDALFWTP
GLATLRQHETEQEQSSEFSSAGSSRYVVHFSRAGYGDDLNLLLGAPFVSS
LHLKSSMKRRLSQSLIQYATNFIHFGDPNKHFTIPNIAQNLAKSWPAFNS
RDELSLKLFKPTVGLNEPLPPNDVLDVASAYRKRYTTFWMKIFPKIAASS
RRTPQCKGRTITHFAVPEVQYGEAAMDGYAPVPPKSTEQVSLSERPSTIY
NETVEFPSFYDTNRMAPLTTEDSKEGYNRIFLLTIVAGLSLFLINIVFTA
TFYFCHQQRKERSSGILISASEADHRENKNSQAAKLTSEMSSCYQSVVRL
PSLSSAVEAPFQLATTKMQTDFQSVAFETLHRSPNQLGQIYPPGGNQATP
MADHQIIAALDSSPKKETHMRPSARYNQANLGNGGWHYYR


Reference
    Title: The genome of the hydatid tapeworm Echinococcus granulosus
    Zheng H, Zhang W, Zhang L, Zhang Z, Li J, Lu G, Zhu Y, Wang Y, Huang Y and Wang S <21 more author(s)>
    Ref: Nat Genet, 45:1168, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer