Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geoka-q5l3h0

Geobacillus kaustophilus , Geobacillus sp., Geobacillus stearothermophilus (Bacillus stearothermophilus), Geobacillus thermoleovorans carboxylesterase (EC 3.1.1.1)

Comment
Other strains: Geobacillus kaustophilus (GBlys) Geobacillus sp. (strains Y412MC61; Y412MC52; CAMR12739 Y412MC52; GHH01; WSUCF1; MAS1; A8; CAMR5420), Geobacillus stearothermophilus (Bacillus stearothermophilus), Geobacillus thermoleovorans (B23; CCB_US3_UF5); Geobacillus sp. 12AMOR1


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Geobacillus kaustophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus thermoleovorans group: N E > Geobacillus kaustophilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: geoka-q5l3h0
Colored MSA for CarbLipBact_2 (raw)
MIGCLCIHGFTGSPEEVAPLADYLRERTDWMIETPTLPGHGSELRLKGIT
YDQWIAAAEQAFLALHHRCSVVYVIGFSMGGVIAVYLAEKYPVAKLVLLS
AAFYYVNPRQLWRDIREMFANGWKGAREHPLFLRYRNKMMATPFSAVREF
RKLVRDVRPRLPRVAAPALIVQGEKDGIVPLKSAYYLYEQIGSAEKKLLL
LPNSFHHVCHSIDRHVLFAEVETFLRAAHAHHCKSPHNMV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIGCLCIHGFTGSPEEVAPLADYLRERTDWMIETPTLPGHGSELRLKGIT
YDQWIAAAEQAFLALHHRCSVVYVIGFSMGGVIAVYLAEKYPVAKLVLLS
AAFYYVNPRQLWRDIREMFANGWKGAREHPLFLRYRNKMMATPFSAVREF
RKLVRDVRPRLPRVAAPALIVQGEKDGIVPLKSAYYLYEQIGSAEKKLLL
LPNSFHHVCHSIDRHVLFAEVETFLRAAHAHHCKSPHNMV


References
2 more
    Title: Draft Genome Sequence of Geobacillus thermoleovorans Strain B23
    Boonmak C, Takahasi Y, Morikawa M
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Complete Genome Sequence of Geobacillus sp. Strain GHH01, a Thermophilic Lipase-Secreting Bacterium
    Wiegand S, Rabausch U, Chow J, Daniel R, Streit WR, Liesegang H
    Ref: Genome Announc, 1:e0009213, 2013 : PubMed

            

    Title: Thermoadaptation trait revealed by the genome sequence of thermophilic Geobacillus kaustophilus
    Takami H, Takaki Y, Chee GJ, Nishi S, Shimamura S, Suzuki H, Matsui S, Uchiyama I
    Ref: Nucleic Acids Research, 32:6292, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer