Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: herar-a4g411

Herminiimonas arsenicoxydans S-formylglutathione hydrolase

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Herminiimonas arsenicoxydans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Oxalobacteraceae: N E > Herminiimonas: N E > Herminiimonas arsenicoxydans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CU207211
1 UniProt : A4G411
1 UniProt : A4G411
1 Interpro : A4G411
1 Pfam : A4G411
1 PIRSF : A4G411
1 SUPERFAM : A4G411
Sequence
Graphical view for this peptide sequence: herar-a4g411
Colored MSA for A85-EsteraseD-FGH (raw)
MELISQHKCFNGVQSFYKHESTSTNFPMTFSVYEPPQAKLHKVPVLFYLA
GLTCTDETFMIKGGAQRYAAEHGIMLVTMDTSPRRTGIKGAGDSWDFGHG
AGFYIDATQEPWSACFRMESYVVQELRNIILAQFPARADRIGVFGHSMGG
HGALTLALKYPEIYQSVSAFAPITAPTEVPWGQKAFSAYLGPDQSTWLQH
DASALMRTRKTPFPQGILIDQGLDDQFLDEQLKPHQFEAACWAADQPLTL
RRHSGYDHNYYFISTFMQDHIAFHSAILNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELISQHKCFNGVQSFYKHESTSTNFPMTFSVYEPPQAKLHKVPVLFYLA
GLTCTDETFMIKGGAQRYAAEHGIMLVTMDTSPRRTGIKGAGDSWDFGHG
AGFYIDATQEPWSACFRMESYVVQELRNIILAQFPARADRIGVFGHSMGG
HGALTLALKYPEIYQSVSAFAPITAPTEVPWGQKAFSAYLGPDQSTWLQH
DASALMRTRKTPFPQGILIDQGLDDQFLDEQLKPHQFEAACWAADQPLTL
RRHSGYDHNYYFISTFMQDHIAFHSAILNK


Reference
    Title: A tale of two oxidation states: bacterial colonization of arsenic-rich environments
    Muller D, Medigue C, Koechler S, Barbe V, Barakat M, Talla E, Bonnefoy V, Krin E, Arsene-Ploetze F and Bertin PN <27 more author(s)>
    Ref: PLoS Genet, 3:e53, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer