Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hetga-g5bze3

Heterocephalus glaber (Naked mole rat) Carboxylesterase 2

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Heterocephalus glaber
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Hystricomorpha: N E > Bathyergidae: N E > Heterocephalus: N E > Heterocephalus glaber: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : JH172552
1 UniProt : G5BZE3
1 UniProt : G5BZE3
1 Interpro : G5BZE3
1 Prodom : G5BZE3
1 Pfam : G5BZE3
1 PIRSF : G5BZE3
1 SUPERFAM : G5BZE3
Sequence
Graphical view for this peptide sequence: hetga-g5bze3
Colored MSA for Carb_B_Chordata (raw)
MGLDQLLTLLRAVTCGLLILHPGQALDSASPIRSTNTGQVRGSLVHVKGT
DVGVHTFLGIPFAKPPVGSLRFAAPEAPEPWSGVRDGTSYPAMCLQDVDI
MKMFNMTTPSVPVAEDCLYLNIYTPAHVHDESRLPVMVWIHGGGLVVGMA
SLYDGSKLAASENVVVVTIQYRLGVLGFFSTEDQHAAGNWGFLDQVAALR
WVQQNIVHFGGNPDGVTIFGESAGGVSVSSLVLSPMSQGLFHGAIMESGV
ALLPGIISSSSENIYTTVANVSGCGQIDSEAMVRCLRGKSEEEILAITKP
FKIIPAVVDGAFLPRHPQELLASADFQPVPSIIGVNSDEYGLVIPMFFGS
TDTQKEMNRETLRTVLQSMSAQMMLPAEFGDLFMEEYIGDIKDPQALKIQ
FHEMMGDFMFMIPALQVAHFHCSHGTVYFYEFQHPPDFLKNIRPPYMKAD
HGDEIPFVFGHFLWDNQVHFTEEEELLNRRMMKYWANFARNGNPNGQGLP
HWPALDHEELYLQLDINPTVGRALKAPRLKFWTETLPQKIQELRRAEEKH
AEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLDQLLTLLRAVTCGLLILHPGQALDSASPIRSTNTGQVRGSLVHVKGT
DVGVHTFLGIPFAKPPVGSLRFAAPEAPEPWSGVRDGTSYPAMCLQDVDI
MKMFNMTTPSVPVAEDCLYLNIYTPAHVHDESRLPVMVWIHGGGLVVGMA
SLYDGSKLAASENVVVVTIQYRLGVLGFFSTEDQHAAGNWGFLDQVAALR
WVQQNIVHFGGNPDGVTIFGESAGGVSVSSLVLSPMSQGLFHGAIMESGV
ALLPGIISSSSENIYTTVANVSGCGQIDSEAMVRCLRGKSEEEILAITKP
FKIIPAVVDGAFLPRHPQELLASADFQPVPSIIGVNSDEYGLVIPMFFGS
TDTQKEMNRETLRTVLQSMSAQMMLPAEFGDLFMEEYIGDIKDPQALKIQ
FHEMMGDFMFMIPALQVAHFHCSHGTVYFYEFQHPPDFLKNIRPPYMKAD
HGDEIPFVFGHFLWDNQVHFTEEEELLNRRMMKYWANFARNGNPNGQGLP
HWPALDHEELYLQLDINPTVGRALKAPRLKFWTETLPQKIQELRRAEEKH
AEL


Reference
    Title: Genome sequencing reveals insights into physiology and longevity of the naked mole rat
    Kim EB, Fang X, Fushan AA, Huang Z, Lobanov AV, Han L, Marino SM, Sun X, Turanov AA and Gladyshev VN <26 more author(s)>
    Ref: Nature, 479:223, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer