(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Lactobacillales: NE > Lactobacillaceae: NE > Lactobacillus: NE > Lactobacillus plantarum: NE
6_AlphaBeta_hydrolase : lacpl-LP.1774Lactobacillus plantarum hydrolase (putative). A85-EsteraseD-FGH : lacpl-EST1Lactobacillus plantarum (and strain JDM1) acetylesterase (EC 3.1.-), lacpl-EST2Lactobacillus plantarum, acetylesterase (EC 3.1.-) Acetyl esterase (Promiscuous) estA lp_3505. AlphaBeta_hydrolase : lacpl-LP.0461Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.1124Lactobacillus plantarum cell surface hydrolase, lacpl-LP.2620Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3265Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3393Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative). BD-FAE : lacpl-Est.1092Lactobacillus plantarum JDM1 Esterase/lipase, lacpl-LP.1002 Lactobacillus plantarum lipase/esterase (putative), lacpl-LP.2923 Lactobacillus plantarum Cest-2923 (lp_2923) lipase/esterase, lacpl-LP.3561Lactobacillus plantarum lipase/esterase (putative) LP_3561, lacpl-LP.3562Lactobacillus plantarum lipase/esterase (putative) LP_3562. CarbLipBact_1 : lacpl-LP.0796 Lactobacillus plantarum; Lactobacillus pentosus, carboxylesterase (EC 3.1.1.1). Duf_915 : lacpl-LP.0618Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.1156Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.1165 Lactobacillus plantarum WCFS1 cell surface hydrolase (putative), lacpl-LP.1935Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.2519Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.2586Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.2737Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3205Lactobacillus plantarum hypothetical protein, lacpl-LP.3341Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative). Haloperoxidase : lacpl-HPOLactobacillus plantarum (and strain JDM1) halo peroxidase (EC 1.11.1.-). Hormone-sensitive_lipase_like : lacpl-LP.0973 Lactobacillus plantarum lipase/esterase. Lactobacillus_peptidase : lacpl-pepxLactobacillus plantarum peptidase (x-prolyl-dipeptidyl aminopeptidase) (x-pdap). Proline_iminopeptidase : lacpl-PEPILactobacillus plantarum prolyl aminopeptidase (EC 3.4.11.5), lacpl-PEPR1Lactobacillus plantarum prolyl aminopeptidase (EC 3.4.11.5), lacpl-PEPR2Lactobacillus plantarum (and strains JDM1; DOMLa) prolyl aminopeptidase (EC 3.4.11.5), lacps-e1ttj7Lactobacillus plantarum (strain ST-III). Prolyl aminopeptidase. Tannase_Bact : lacpl-tanL Lactobacillus plantarum Tannase (Tannin acylhydrolase) LP.2956 tanL TanBLp. yjfP_esterase-like : lacpl-LP.1760Lactobacillus plantarum lipase/esterase (putative), lacpl-LP.2631Lactobacillus plantarum lipase/esterase (putative)
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Lactobacillus plantarum subsp. plantarum ATCC 14917: N, E.
Lactobacillus plantarum JDM1: N, E.
Lactobacillus plantarum ZJ316: N, E.
Lactobacillus plantarum 2165: N, E.
Lactobacillus plantarum subsp. plantarum P-8: N, E.
Lactobacillus plantarum 16: N, E.
Lactobacillus plantarum 4_3: N, E.
Lactobacillus plantarum 2025: N, E.
Lactobacillus plantarum UCMA 3037: N, E.
Lactobacillus plantarum IPLA88: N, E.
Lactobacillus plantarum WJL: N, E.
Lactobacillus plantarum subsp. plantarum ST-III: N, E.
Lactobacillus plantarum WCFS1: N, E.
Lactobacillus plantarum subsp. plantarum NC8: N, E.
Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437: N, E.
Lactobacillus plantarum CMPG5300: N, E.
Lactobacillus plantarum DOMLa: N, E.
Lactobacillus plantarum AY01: N, E.
Lactobacillus plantarum EGD-AQ4: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MTSMEFKIKRDGLALQARLETPAAPSSTLVILMHGFTADMGYDTTQFVPQ LAQALVAHGLAVLRFDFNGHGCSEGRFQDMTVINEIADAKAVLDEALTLH YDHIVLAGHSQGGVVASMLAGYYPDVVDKLILMAPAATLKSDAQQGVLQG ATYDPQHIPAYLNIRDGLKVGGFYLRTAQQLPIYEVAQQYAGSVTLIHVT ADTVVSPQASEKYHEVYQHSQLHWVQDGGHRFSGDARATAIQLALAAFK
A high variety of plants that are used for food production contain esterified hydroxycinnamic acids. As their free forms display several benefits, like an enhanced absorption in human intestinal tract, anti-oxidative and anti-carcinogenic effects, an improved protein solubility and reduced discoloration, the microbial ability to cleave the ester bond is highly desired. In order to examine potential fermentation strains for this purpose, six different lactic acid bacteria and one bifidobacterial strain were screened for their ability to degrade esterified hydroxycinnamic acids because these strains are commonly used for fermentation of plant-based foods. Moreover, their cinnamoyl esterase activity was examined by molecular biological analyses. The enzymes were heterologously expressed in Escherichia coli, purified and biochemically characterized. The purified esterases with a molecular mass around 27-29 kDa had their optimum predominantly between pH 7 and 8 at 20-30 degreesC. Bifidobacterium animalis subsp. lactis, Lactobacillus gasseri, Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus fermentum displayed activities against a broad substrate range (methyl caffeate, methyl trans-p-coumarate, chlorogenic acid as well as partially ethyl ferulate). Concerning substrate affinity, reaction velocity, thermal and pH stability, Lactobacillus gasseri showed the overall best performance. The herein studied lactic acid- and bifidobacteria are promising for the production of fermented plant-based foods with an increased quality and nutritional value.
The 3,308,274-bp sequence of the chromosome of Lactobacillus plantarum strain WCFS1, a single colony isolate of strain NCIMB8826 that was originally isolated from human saliva, has been determined, and contains 3,052 predicted protein-encoding genes. Putative biological functions could be assigned to 2,120 (70%) of the predicted proteins. Consistent with the classification of L. plantarum as a facultative heterofermentative lactic acid bacterium, the genome encodes all enzymes required for the glycolysis and phosphoketolase pathways, all of which appear to belong to the class of potentially highly expressed genes in this organism, as was evident from the codon-adaptation index of individual genes. Moreover, L. plantarum encodes a large pyruvate-dissipating potential, leading to various end-products of fermentation. L. plantarum is a species that is encountered in many different environmental niches, and this flexible and adaptive behavior is reflected by the relatively large number of regulatory and transport functions, including 25 complete PTS sugar transport systems. Moreover, the chromosome encodes >200 extracellular proteins, many of which are predicted to be bound to the cell envelope. A large proportion of the genes encoding sugar transport and utilization, as well as genes encoding extracellular functions, appear to be clustered in a 600-kb region near the origin of replication. Many of these genes display deviation of nucleotide composition, consistent with a foreign origin. These findings suggest that these genes, which provide an important part of the interaction of L. plantarum with its environment, form a lifestyle adaptation region in the chromosome.