Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: legph-q5zwi2

Legionella pneumophila Putative uncharacterized protein

Comment
Other strains: Paris; Leg01/20; 121004; Leg01/11; Leg01/53; serogroup 1 (strain 2300/99 Alcoy); Corby subsp. pneumophila str. Thunder Bay.; ATCC 43290; LPE509;Philadelphia 1 / ATCC 33152 / DSM 7513).


Relationship
Family|Fungal-Bact_LIP
Block| X
Position in NCBI Life Tree|Legionella pneumophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Legionellales: N E > Legionellaceae: N E > Legionella: N E > Legionella pneumophila: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4EZI: Crystal structure of a hypothetical protein (lpg1103) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 1.15 A resolution
No kinetic





No Substrate
No inhibitor
>3 Genbank links 9 more: CP003730, CP003192, CP003885
1 UniProt : Q5ZWI2
1 Structure : 4EZI
1 UniProt : Q5ZWI2
1 Interpro : Q5ZWI2
1 Prodom : Q5ZWI2
1 Pfam : Q5ZWI2
1 PIRSF : Q5ZWI2
1 SUPERFAM : Q5ZWI2
Sequence
Graphical view for this peptide sequence: legph-q5zwi2
Colored MSA for Fungal-Bact_LIP (raw)
MVMKTMRLFKGILFTFCGIIFCFNSHAALEHEKLVNYIALGEFSRETAEI
ALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQV
GIISYQHGTRFERNDVPSRNNEKNYIYLAAYGNSAGYMTVMPDYLGLGDN
ELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFS
TIVMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATAYLAY
FFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEILQALPQDPLL
IFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYA
GAEMAYHSFRKYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEA
MNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVMKTMRLFKGILFTFCGIIFCFNSHAALEHEKLVNYIALGEFSRETAEI
ALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQV
GIISYQHGTRFERNDVPSRNNEKNYIYLAAYGNSAGYMTVMPDYLGLGDN
ELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFS
TIVMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATAYLAY
FFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEILQALPQDPLL
IFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYA
GAEMAYHSFRKYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEA
MNK


References
2 more
    Title: Comparative Genomics Reveal That Host-Innate Immune Responses Influence the Clinical Prevalence of Serogroups
    Khan MA, Knox N, Prashar A, Alexander D, Abdel-Nour M, Duncan C, Tang P, Amatullah H, Dos Santos CC and Guyard C <6 more author(s)>
    Ref: PLoS ONE, 8:e67298, 2013 : PubMed

            

    Title: Genome Sequence of an Environmental Isolate of the Bacterial Pathogen Legionella pneumophila
    Ma J, He Y, Hu B, Luo ZQ
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Whole-genome sequence of the human pathogen Legionella pneumophila serogroup 12 strain 570-CO-H
    Amaro F, Gilbert JA, Owens S, Trimble W, Shuman HA
    Ref: Journal of Bacteriology, 194:1613, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer