Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myobr-s7mf99

Myotis brandtii (Brandt's bat) Cholinesterase

Relationship
Family|BCHE
Block| C
Position in NCBI Life Tree|Myotis brandtii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Chiroptera: N E > Microchiroptera: N E > Vespertilionidae: N E > Myotis: N E > Myotis brandtii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KE161218
1 UniProt : S7MF99
1 UniProt : S7MF99
1 Interpro : S7MF99
1 Pfam : S7MF99
1 PIRSF : S7MF99
1 SUPERFAM : S7MF99
Sequence
Graphical view for this peptide sequence: myobr-s7mf99
Colored MSA for BCHE (raw)
MQSKGTIVCTQLLFMFLLLWMLIGKSHTEEDIIITTKNGKVRGMNLSVLG
GTVTAFLGIPYAQPPLGRLRFKKPQSLAKWSNIWNATKYANSCYQNTDQS
FPGFLGSEMWNPNTDLSEDCLYLNVWIPVPKPKNATVMVWIYGGGFQTGT
SSLPVYDGKFLARVERVIVVSMNYRVGALGFLALPGNSEAPGNMGLFDQQ
LALHWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPRSHPLFTRAIL
QSGSANAPWAVTSLDEAKNRTLTLAKFIGCFRENETEIIKCLRNKDPQEI
LLNEVFVVPYDTLLSVSFGPTVDGDFLTDMPDTLLQLGQFKKTQILVGVN
KDEGTAFLVYGAPGFSKDNNSIITRKEFQESLKIFFRGVSEFGRESILFH
YMDWLDDQRAEKYREALDDVVGDYNFICPALEFTKKFSDLGNNAFFYYFE
HRSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYTKSEEILSRSIMKHWA
NFAKYGSPNGTQNSSTSWPVFKSTEQKYLTLNTESPKIYTKLRAQQCRFW
TLFFPKVLEMTGNIDEAEQEWKAGFHRWNNYMMDWKNQFNDYTSKKASCA
GL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQSKGTIVCTQLLFMFLLLWMLIGKSHTEEDIIITTKNGKVRGMNLSVLG
GTVTAFLGIPYAQPPLGRLRFKKPQSLAKWSNIWNATKYANSCYQNTDQS
FPGFLGSEMWNPNTDLSEDCLYLNVWIPVPKPKNATVMVWIYGGGFQTGT
SSLPVYDGKFLARVERVIVVSMNYRVGALGFLALPGNSEAPGNMGLFDQQ
LALHWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPRSHPLFTRAIL
QSGSANAPWAVTSLDEAKNRTLTLAKFIGCFRENETEIIKCLRNKDPQEI
LLNEVFVVPYDTLLSVSFGPTVDGDFLTDMPDTLLQLGQFKKTQILVGVN
KDEGTAFLVYGAPGFSKDNNSIITRKEFQESLKIFFRGVSEFGRESILFH
YMDWLDDQRAEKYREALDDVVGDYNFICPALEFTKKFSDLGNNAFFYYFE
HRSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYTKSEEILSRSIMKHWA
NFAKYGSPNGTQNSSTSWPVFKSTEQKYLTLNTESPKIYTKLRAQQCRFW
TLFFPKVLEMTGNIDEAEQEWKAGFHRWNNYMMDWKNQFNDYTSKKASCA
GL


Reference
    Title: Genome analysis reveals insights into physiology and longevity of the Brandt's bat Myotis brandtii
    Seim I, Fang X, Xiong Z, Lobanov AV, Huang Z, Ma S, Feng Y, Turanov AA, Zhu Y and Gladyshev VN <19 more author(s)>
    Ref: Nat Commun, 4:2212, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer