Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ogapd-w1qjr8

Ogataea parapolymorpha (Yeast) (Hansenula polymorpha). Histone deacetylase HDA1

Comment
Other strains: Ogataea polymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha)


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Ogataea parapolymorpha
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Pichiaceae: N E > Ogataea: N E > Ogataea parapolymorpha: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: ogapd-w1qjr8
Colored MSA for Arb2_domain (raw)
VSDAIRAYQKEELFEKRHFVPLPILTEKLPESSSLRDLVLCSPDVYQADK
LVIVVHDSARVWARRDPVTGTLDSASAVVVDQSLRFLDWALDQQYGVVDI
NVPLSISGSEDAQYNNISSAQDVLLYLWDHYIQYFKVSKIAFVGVGDAYN
GVVHLCGHRDVRGLVKCSVNYLDRATALRAIVSSIDESVVDWFYQNSLVF
TAAKHPCWGDVEKNGSSKRPRKKYGRVLRADVEGVDNIIEERLEEGCDFI
QDSLEDYDSDSE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VSDAIRAYQKEELFEKRHFVPLPILTEKLPESSSLRDLVLCSPDVYQADK
LVIVVHDSARVWARRDPVTGTLDSASAVVVDQSLRFLDWALDQQYGVVDI
NVPLSISGSEDAQYNNISSAQDVLLYLWDHYIQYFKVSKIAFVGVGDAYN
GVVHLCGHRDVRGLVKCSVNYLDRATALRAIVSSIDESVVDWFYQNSLVF
TAAKHPCWGDVEKNGSSKRPRKKYGRVLRADVEGVDNIIEERLEEGCDFI
QDSLEDYDSDSE


References
    Title: Comparative genomics of biotechnologically important yeasts
    Riley R, Haridas S, Wolfe KH, Lopes MR, Hittinger CT, Goker M, Salamov AA, Wisecaver JH, Long TM and Jeffries TW <29 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 113:9882, 2016 : PubMed

            

    Title: Genome sequence and analysis of methylotrophic yeast Hansenula polymorpha DL1
    Ravin NV, Eldarov MA, Kadnikov VV, Beletsky AV, Schneider J, Mardanova ES, Smekalova EM, Zvereva MI, Dontsova OA and Skryabin KG <1 more author(s)>
    Ref: BMC Genomics, 14:837, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer