Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phano-q0udp4

Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum) Putative uncharacterized protein

Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Phaeosphaeria nodorum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > dothideomyceta: N E > Dothideomycetes: N E > Pleosporomycetidae: N E > Pleosporales: N E > Pleosporineae: N E > Phaeosphaeriaceae: N E > Parastagonospora: N E > Parastagonospora nodorum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CH445340
1 UniProt : Q0UDP4
1 UniProt : Q0UDP4
1 Interpro : Q0UDP4
1 Pfam : Q0UDP4
1 PIRSF : Q0UDP4
1 SUPERFAM : Q0UDP4
Sequence
Graphical view for this peptide sequence: phano-q0udp4
Colored MSA for Duf_1749 (raw)
MASKPFGVTVHPFTSPTPSACAYERGNTSSRNALVYIDGLTGGPHRARHL
NPLIEALQADSELSYSFWEFRMRSSYTGFGFSSLANDVEDISALVTHLRE
LGKENIVLLGSSTGCQGILTYVSSDASTPVNAYILQAPTSDRELGSLLMP
ADFLAQTLKHAEEMIARGEKDEIMPKSLIPPIFSSPVTAYRWHSLIAKGG
DDDFFSSDLADEALVVTFGKLDKPTLIIPSENDEMVPPTVDKKTLLQRWI
KVAPEGMVSELSGLNPGADHQLSEEGTQLWFTDRVLRFLKTLN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASKPFGVTVHPFTSPTPSACAYERGNTSSRNALVYIDGLTGGPHRARHL
NPLIEALQADSELSYSFWEFRMRSSYTGFGFSSLANDVEDISALVTHLRE
LGKENIVLLGSSTGCQGILTYVSSDASTPVNAYILQAPTSDRELGSLLMP
ADFLAQTLKHAEEMIARGEKDEIMPKSLIPPIFSSPVTAYRWHSLIAKGG
DDDFFSSDLADEALVVTFGKLDKPTLIIPSENDEMVPPTVDKKTLLQRWI
KVAPEGMVSELSGLNPGADHQLSEEGTQLWFTDRVLRFLKTLN


Reference
    Title: Dothideomycete plant interactions illuminated by genome sequencing and EST analysis of the wheat pathogen Stagonospora nodorum
    Hane JK, Lowe RG, Solomon PS, Tan KC, Schoch CL, Spatafora JW, Crous PW, Kodira C, Birren BW and Oliver RP <3 more author(s)>
    Ref: Plant Cell, 19:3347, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer