Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseu2-q4zmb0

Pseudomonas syringae pv. syringae (strain B728a) bioh protein

Relationship
Family|BioH
Block| X
Position in NCBI Life Tree|Pseudomonas syringae pv. syringae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas syringae group: N E > Pseudomonas syringae group genomosp. 1: N E > Pseudomonas syringae: N E > Pseudomonas syringae pv. syringae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000075
1 UniProt : Q4ZMB0
1 UniProt : Q4ZMB0
1 Interpro : Q4ZMB0
1 Pfam : Q4ZMB0
1 PIRSF : Q4ZMB0
1 SUPERFAM : Q4ZMB0
Sequence
Graphical view for this peptide sequence: pseu2-q4zmb0
Colored MSA for BioH (raw)
MRDRLILLPGWGLGVSPLEPLAAALRGLDEHLRVEIEPLPDIDSCDLPDW
LDELDTNLPDDAWLGGWSLGGMLAAELAARRGDRCCGLLTLASNACFVTQ
GAWPNAMPAQDFEAFLAGCADDPDLTLKRFSLLCTQGAEDPRGLARLLKA
GAPHLSKTALLDGLKILRQLDTRSALQTYRGPQLHLFAGLDAFVPAEAAG
DLLALLPDVEVGLIEQASHAFLLENPHGVAAAIHAFLHELDDD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRDRLILLPGWGLGVSPLEPLAAALRGLDEHLRVEIEPLPDIDSCDLPDW
LDELDTNLPDDAWLGGWSLGGMLAAELAARRGDRCCGLLTLASNACFVTQ
GAWPNAMPAQDFEAFLAGCADDPDLTLKRFSLLCTQGAEDPRGLARLLKA
GAPHLSKTALLDGLKILRQLDTRSALQTYRGPQLHLFAGLDAFVPAEAAG
DLLALLPDVEVGLIEQASHAFLLENPHGVAAAIHAFLHELDDD


Reference
    Title: Comparison of the complete genome sequences of Pseudomonas syringae pv. syringae B728a and pv. tomato DC3000
    Feil H, Feil WS, Chain P, Larimer F, DiBartolo G, Copeland A, Lykidis A, Trong S, Nolan M and Lindow SE <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 102:11064, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer