(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Pseudonocardiales: NE > Pseudonocardiaceae: NE > Saccharopolyspora: NE > Saccharopolyspora erythraea: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Saccharopolyspora erythraea NRRL 2338: N, E.
Saccharopolyspora erythraea D: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MTKVEVDTPHGPARAELHCAEEGRAALLLGHGAGGGISAPDLVAVTRAAT AADVHVALVEQPYRVAGRRAPAPAKQLDAAWLAVAEDLGERWFADLPLIF GGRSSGARVACRTAEAGEASAVLCLAFPLHPPGKPEKSRLAELDGVESPV LVVQGERDSFGQPEPSHNREVVLVPGDHSLKADTDSVFRAAQEWLGRILR LVE
References
Title: Genome Sequence of Saccharopolyspora erythraea D, a Hyperproducer of Erythromycin Liu WB, Yu WB, Gao SH, Ye BC Ref: Genome Announc, 1:, 2013 : PubMed
Saccharopolyspora erythraea is a Gram-positive bacterium that can produce antibiotics. However, this microorganism must often be genetically improved for higher production before it can be used in an industrial setting. Here, we report the whole-genome sequence of the industrial hyperproducer strong mutator Saccharopolyspora erythraea strain D.
Saccharopolyspora erythraea is used for the industrial-scale production of the antibiotic erythromycin A, derivatives of which play a vital role in medicine. The sequenced chromosome of this soil bacterium comprises 8,212,805 base pairs, predicted to encode 7,264 genes. It is circular, like those of the pathogenic actinomycetes Mycobacterium tuberculosis and Corynebacterium diphtheriae, but unlike the linear chromosomes of the model actinomycete Streptomyces coelicolor A3(2) and the closely related Streptomyces avermitilis. The S. erythraea genome contains at least 25 gene clusters for production of known or predicted secondary metabolites, at least 72 genes predicted to confer resistance to a range of common antibiotic classes and many sets of duplicated genes to support its saprophytic lifestyle. The availability of the genome sequence of S. erythraea will improve insight into its biology and facilitate rational development of strains to generate high-titer producers of clinically important antibiotics.
Saccharopolyspora erythraea (Streptomyces erythraeus) deoxyerythronolide b synthase III (debs 3) Thioesterase domain