shifl-YIEL

 
Shigella flexneri (Strains (serotype 5b (strain 8401); 2a str. 2457T) Shigella sonnei 53G putative xylanase

Relationship
Block X
Shigella flexneri position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: CP000266, AE015381, AE005674
2 UniProt : Q820C4, Q0SYR4
2 UniProtTrembl : Q820C4, Q0SYR4
2 Interpro : Q820C4, Q0SYR4
2 Prodom : Q820C4, Q0SYR4
2 Pfam : Q820C4, Q0SYR4
2 PIRSF : Q820C4, Q0SYR4
2 SUPERFAM : Q820C4, Q0SYR4
2 QuickSwissBlast : Q820C4, Q0SYR4
 
Sequence
Graphical view for this peptide sequence: shifl-YIEL
Colored MSA for A85-Feruloyl-Esterase (raw)
MVMELNERNITMNIKIAALTLAIASGISAQWAIAADMPASPAPTIPVKQY
VTQVNADNSVTFRYFAPGAKNVSVVVGVPVPDNIHPMTKDEAGVWSWRTP
ILKGNLYEYFFNVDGVRSIDTGTAMTKPQRQVNSSMILVPGSYLDTRSVA
HGDLIAITYHSNALQSERQMYVWTPPGYTGMGEPLPVLYFYHGFGDTGRS
AIDQGRIPQIMDNLLAEGKIKPMLVVIPDTETDAKGIIPEDFVPQERRKV
FYPLNAKAADRELMNDIIPLISKRFSVRKDADGRALAGLSQGGYQALVSG
MNHLESFGWLATFSGVTTTTVPDEGVAARLNDPAAINQQLRNFTVVVGDK
DVVTGKDIAGLKTELEQKKIKFDYQEYPGLNHEMDVWRPAYAAFVQKFKI
RH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVMELNERNITMNIKIAALTLAIASGISAQWAIAADMPASPAPTIPVKQY
VTQVNADNSVTFRYFAPGAKNVSVVVGVPVPDNIHPMTKDEAGVWSWRTP
ILKGNLYEYFFNVDGVRSIDTGTAMTKPQRQVNSSMILVPGSYLDTRSVA
HGDLIAITYHSNALQSERQMYVWTPPGYTGMGEPLPVLYFYHGFGDTGRS
AIDQGRIPQIMDNLLAEGKIKPMLVVIPDTETDAKGIIPEDFVPQERRKV
FYPLNAKAADRELMNDIIPLISKRFSVRKDADGRALAGLSQGGYQALVSG
MNHLESFGWLATFSGVTTTTVPDEGVAARLNDPAAINQQLRNFTVVVGDK
DVVTGKDIAGLKTELEQKKIKFDYQEYPGLNHEMDVWRPAYAAFVQKFKI
RH

no DNA




References
    Title: Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
    Nie H, Yang F, Zhang X, Yang J, Chen L, Wang J, Xiong Z, Peng J, Sun L and Jin Q <6 more author(s)>
    Ref: BMC Genomics, 7:173, 2006 : PubMed

            

    Title: Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T
    Wei J, Goldberg MB, Burland V, Venkatesan MM, Deng W, Fournier G, Mayhew GF, Plunkett G, 3rd, Rose DJ and Blattner FR <7 more author(s)>
    Ref: Infect Immun, 71:2775, 2003 : PubMed

            

    Title: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157
    Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J and Yu J <23 more author(s)>
    Ref: Nucleic Acids Research, 30:4432, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer