Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: shifl-ycfp

Shigella flexneri, Shigella sonnei, Shigella boydii, Shigella dysenteriae, hypothetical protein ycfp UPF0227 protein ycfP

Comment
Other strains: Shigella flexneri (serotype X 2002017; serotype 5b 8401; K-227; 1235-66; K-1770; K-272; 5a str. M90T; 2747-71; 2850-71; K-304; K-315; 2a str. 2457T; J1713; K-671; 1485-80; 1235-66; VA-6; 6603-63; K-218; K-404; CCH060; 4343-70; 2930-71; CDC 796-83) Shigella sonnei (3233-85; 3226-85; 4822-66; Moseley; 53G), Shigella boydii (serotype 4 and 18 (strain CDC3083-94/BS512); ATCC 9905; 965-58; 5216-82; 3594-74; 4444-74) Shigella dysenteriae (serotype 1 Sd197; 1012; 1617; 225-75; CDC 74-1112; 155-74); Shigella sp. D9


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Shigella flexneri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella flexneri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 37 more: CP000038, CP001063, AAMJ02000018
>3 UniProt links 9 more: Q3Z309, P0A8E4, D2ACW6
>3 UniProt links 9 more: Q3Z309, P0A8E4, D2ACW6
>3 Interpro links 9 more: Q3Z309, P0A8E4, D2ACW6
>3 Prodom links 9 more: Q3Z309, P0A8E4, D2ACW6
>3 Pfam links 9 more: Q3Z309, P0A8E4, D2ACW6
>3 PIRSF links 9 more: Q3Z309, P0A8E4, D2ACW6
>3 SUPERFAM links 9 more: Q3Z309, P0A8E4, D2ACW6
Sequence
Graphical view for this peptide sequence: shifl-ycfp
Colored MSA for abh_upf00227 (raw)
MIIYLHGFDSNSPGNHEKVLQLQFIDPDVRLISYSTRHPKHDMQHLLKEV
DKMLQLNVDERPLICGVGLGGYWAERIGFLCDIRQVIFNPNLFPYENMEG
KIDRPEEYADIATKCVTNFREKNRDRCLVILSRNDEALNSQRTSEELHHY
YEIVWDEEQTHKFKNISPHLQRIKAFKTLG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIIYLHGFDSNSPGNHEKVLQLQFIDPDVRLISYSTRHPKHDMQHLLKEV
DKMLQLNVDERPLICGVGLGGYWAERIGFLCDIRQVIFNPNLFPYENMEG
KIDRPEEYADIATKCVTNFREKNRDRCLVILSRNDEALNSQRTSEELHHY
YEIVWDEEQTHKFKNISPHLQRIKAFKTLG


References
    Title: Emergence of a new multidrug-resistant serotype X variant in an epidemic clone of Shigella flexneri
    Ye C, Lan R, Xia S, Zhang J, Sun Q, Zhang S, Jing H, Wang L, Li Z and Xu J <11 more author(s)>
    Ref: J Clin Microbiol, 48:419, 2010 : PubMed

            

    Title: Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
    Nie H, Yang F, Zhang X, Yang J, Chen L, Wang J, Xiong Z, Peng J, Sun L and Jin Q <6 more author(s)>
    Ref: BMC Genomics, 7:173, 2006 : PubMed

            

    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer