Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strhe-ShHTL1

Striga hermonthica (Purple witchweed) (Buchnera hermonthica) hyposensitive to light 1

Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Striga hermonthica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Lamiales: N E > Orobanchaceae: N E > Buchnereae: N E > Striga: N E > Striga hermonthica: N E


Molecular evidence
Database
No mutation
1 structure:
5Z7W: Crystal structure of the strigolactone receptor from Striga hermonthica HTL1 (ShHTL1)
No kinetic





No Substrate
No inhibitor
1 Genbank : ALB07156
1 UniProt : A0A0M4AV81
1 Structure : 5Z7W
1 UniProt : A0A0M4AV81
1 Interpro : A0A0M4AV81
1 Prodom : A0A0M4AV81
1 Pfam : A0A0M4AV81
1 PIRSF : A0A0M4AV81
1 SUPERFAM : A0A0M4AV81
Sequence
Graphical view for this peptide sequence: strhe-ShHTL1
Colored MSA for RsbQ-like (raw)
MGLAQEAHNVRVLGSGPQTVVLAHGFGTDQSVWKYLVPHLVEDYRVVLFD
IMGAGTTNPTYFNFERYSSLEGYAGDVIAILEELQISSCVYVGHSVSAMI
GVIASVTRPDLFTKLVTVAGSPRYLNDPDYFGGFDLDELHELFEAMKENY
KAWCSGFAPLCVGADMESLAVQEFSRTLFNMRPDIALSILQTIFYSDVRP
LLPHVTVPCHIIQSVKDLAVPVAVSEYIHQSLGGESILEVMATEGHLPQL
SSPDVVVPVLLRHIRYAIARPN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLAQEAHNVRVLGSGPQTVVLAHGFGTDQSVWKYLVPHLVEDYRVVLFD
IMGAGTTNPTYFNFERYSSLEGYAGDVIAILEELQISSCVYVGHSVSAMI
GVIASVTRPDLFTKLVTVAGSPRYLNDPDYFGGFDLDELHELFEAMKENY
KAWCSGFAPLCVGADMESLAVQEFSRTLFNMRPDIALSILQTIFYSDVRP
LLPHVTVPCHIIQSVKDLAVPVAVSEYIHQSLGGESILEVMATEGHLPQL
SSPDVVVPVLLRHIRYAIARPN


References
    Title: Structural analysis of HTL and D14 proteins reveals the basis for ligand selectivity in Striga
    Xu Y, Miyakawa T, Nosaki S, Nakamura A, Lyu Y, Nakamura H, Ohto U, Ishida H, Shimizu T and Tanokura M <1 more author(s)>
    Ref: Nat Commun, 9:3947, 2018 : PubMed

            

    Title: Structure-function analysis identifies highly sensitive strigolactone receptors in Striga
    Toh S, Holbrook-Smith D, Stogios PJ, Onopriyenko O, Lumba S, Tsuchiya Y, Savchenko A, McCourt P
    Ref: Science, 350:203, 2015 : PubMed

            

    Title: PARASITIC PLANTS. Probing strigolactone receptors in Striga hermonthica with fluorescence
    Tsuchiya Y, Yoshimura M, Sato Y, Kuwata K, Toh S, Holbrook-Smith D, Zhang H, McCourt P, Itami K and Hagihara S <1 more author(s)>
    Ref: Science, 349:864, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer