Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: syns3-q0ibv4

Synechococcus sp. (strain CC9311). Uncharacterized protein

Relationship
Family|Chlorophyllase
Block| L
Position in NCBI Life Tree|Synechococcus sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Synechococcales: N E > Synechococcaceae: N E > Synechococcus: N E > Synechococcus sp.: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000435
1 UniProt : Q0IBV4
1 UniProt : Q0IBV4
1 Interpro : Q0IBV4
1 Prodom : Q0IBV4
1 Pfam : Q0IBV4
1 PIRSF : Q0IBV4
1 SUPERFAM : Q0IBV4
Sequence
Graphical view for this peptide sequence: syns3-q0ibv4
Colored MSA for Chlorophyllase (raw)
MKFKSNLLKYVAFNILALFATFLSPRVVPEVLAAQNDYSGPGPFSVSVST
VEGQGLLFKPSDSDESRKNWPGVVFAHGLCGPAEKYSTTLSRLASWGFIV
IANQEQGDCGVINVNHPLATLGNLFQLPLKFSNAVDFSSMADDIRSNLNY
LAGRSDVDSGRLALMGHSMGGGMVIDVASELGEQQSNIVKAVVAIAPWNG
VQPTPSSIVNNSNTPILIFCSMTDALCPCSGEVQLSDTQAVFTNNVSPMI
PLLFGPQSDPTWDGGSMAILKNSKDAVLMNVNQVSHFTIAGIDNGGEMQS
FADWARGETGLNFNRPSRPYSDIPTMEYAVAFLNQSLNLDVKTGRSFLDQ
SSSDSRLVEVVSSN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFKSNLLKYVAFNILALFATFLSPRVVPEVLAAQNDYSGPGPFSVSVST
VEGQGLLFKPSDSDESRKNWPGVVFAHGLCGPAEKYSTTLSRLASWGFIV
IANQEQGDCGVINVNHPLATLGNLFQLPLKFSNAVDFSSMADDIRSNLNY
LAGRSDVDSGRLALMGHSMGGGMVIDVASELGEQQSNIVKAVVAIAPWNG
VQPTPSSIVNNSNTPILIFCSMTDALCPCSGEVQLSDTQAVFTNNVSPMI
PLLFGPQSDPTWDGGSMAILKNSKDAVLMNVNQVSHFTIAGIDNGGEMQS
FADWARGETGLNFNRPSRPYSDIPTMEYAVAFLNQSLNLDVKTGRSFLDQ
SSSDSRLVEVVSSN


Reference
    Title: Genome sequence of Synechococcus CC9311: Insights into adaptation to a coastal environment
    Palenik B, Ren Q, Dupont CL, Myers GS, Heidelberg JF, Badger JH, Madupu R, Nelson WC, Brinkac LM and Paulsen IT <7 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:13555, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer