Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: syny3-y249

Synechocystis sp. (strain PCC 6803) Uncharacterized protein sll0249

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Synechocystis sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Synechococcales: N E > Merismopediaceae: N E > Synechocystis: N E > Synechocystis sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BA000022
1 UniProt : P73883
1 UniProt : P73883
1 Interpro : P73883
1 Prodom : P73883
1 Pfam : P73883
1 PIRSF : P73883
1 SUPERFAM : P73883
Sequence
Graphical view for this peptide sequence: syny3-y249
Colored MSA for AlphaBeta_hydrolase (raw)
MTNQNMPPETPIIWLNFSPALRRFDRPLLRQLGKSQAILQWDYHQTADEP
NCLTVGLDLIGEYLENFHQPVHLIGHSTSGLLALLYARQCPEKVRSLSLL
SVGVYPALDWQAHYYSQFDAMRYSRHLLLGQMAHHLFNCRSLRQTQTIVN
ILENDLLTSISPHSLYKQLIILPNHIAVPLLVAVGETDGIIDTSLFNGWQ
RWKKPGDRLWLCPEGKYFFQFEHPEITAFQLQQFWRSLQGQEASSSTSLL
A
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTNQNMPPETPIIWLNFSPALRRFDRPLLRQLGKSQAILQWDYHQTADEP
NCLTVGLDLIGEYLENFHQPVHLIGHSTSGLLALLYARQCPEKVRSLSLL
SVGVYPALDWQAHYYSQFDAMRYSRHLLLGQMAHHLFNCRSLRQTQTIVN
ILENDLLTSISPHSLYKQLIILPNHIAVPLLVAVGETDGIIDTSLFNGWQ
RWKKPGDRLWLCPEGKYFFQFEHPEITAFQLQQFWRSLQGQEASSSTSLL
A


Reference
    Title: Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp. strain PCC6803. II. Sequence determination of the entire genome and assignment of potential protein-coding regions
    Kaneko T, Sato S, Kotani H, Tanaka A, Asamizu E, Nakamura Y, Miyajima N, Hirosawa M, Sugiura M and Tabata S <14 more author(s)>
    Ref: DNA Research, 3:109, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer